SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_04710 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_04710
Domain Number 1 Region: 12-187
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.55e-23
Family Ankyrin repeat 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm1_04710
Sequence length 187
Comment | Brugia malayi conserved hypothetical protein (187 aa)
Sequence
MNAKFLEAIDLLRDNNVTQFEKLIKQFPQLLEIRRRGRSLLTYALLYDRLRALQIISKRS
KSSFDGEDCSESALHWIAKFDARKCCKYLLSLPRQYSEIPWIVIKNNRQITPIHLAAHYG
HVKILKMLLQSTVLDSENFYQMVNDNVGRSPLHYAACTARLECCEVLLDEKLGLPVDQKD
RNGHTPL
Download sequence
Identical sequences XP_001892420.1.25112 Bm1_04710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]