SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_05930 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_05930
Domain Number 1 Region: 155-244
Classification Level Classification E-value
Superfamily SEA domain 0.00000392
Family SEA domain 0.0074
Further Details:      
 
Domain Number 2 Region: 50-86
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00004
Family EGF-type module 0.039
Further Details:      
 
Weak hits

Sequence:  Bm1_05930
Domain Number - Region: 3-137
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000455
Family Growth factor receptor domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1_05930
Sequence length 287
Comment | Brugia malayi Muscle positioning protein 4, putative (288 aa)
Sequence
MVNECTNSHLNNCSRFADCIDREDGYECVCKTGYRDGNPAKPGTDCKLIVNECQSSNLNN
CDKNAECIDTEEGYQCKCIPPYIDQNPSQPGTVCRKKGIPCGDTACQEELGEICSENQLC
ICPPGQKRSGPEKKCRPVESWSLPLLVIRQNTEELNYNDNLRNPQSDQYKELVSAFEKGI
AESYANTSLKNGFVVAEVNEIARPSDFIKQWDKGILYNFTVNFVRGSVASPESVFTELLQ
YIAHRNNFEVGKSKQFISPYQANPFDNCYKSDCHPDAKCTATPTGYR
Download sequence
Identical sequences Bm1_05930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]