SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_09655 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_09655
Domain Number 1 Region: 4-185
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.63e-39
Family Ankyrin repeat 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm1_09655
Sequence length 202
Comment | Brugia malayi Ankyrin homolog precursor, putative (203 aa)
Sequence
HDFVFACTSGDWTSVMNLLDAVSIDELRSGLIAASSRGHADICKLILQADPHAANYVDSQ
QWNALRSAACNNHDNVVDLLIQNGVEVDECGEGGRTALRAAAWSGHECVVQRLLKCNANV
DKQDAEGRTALMAAAFMDHANIVSILLADGASPNIMDNYGSTALHLALSSGAQTSDHNET
VAMLIKGVCSSLHQKIILLNRK
Download sequence
Identical sequences Bm1_09655 XP_001893404.1.25112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]