SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_13930 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_13930
Domain Number 1 Region: 1486-1744
Classification Level Classification E-value
Superfamily YWTD domain 2.22e-49
Family YWTD domain 0.00000943
Further Details:      
 
Domain Number 2 Region: 409-669
Classification Level Classification E-value
Superfamily YWTD domain 8.89e-38
Family YWTD domain 0.0000432
Further Details:      
 
Domain Number 3 Region: 2125-2361
Classification Level Classification E-value
Superfamily YWTD domain 3.92e-31
Family YWTD domain 0.00012
Further Details:      
 
Domain Number 4 Region: 1819-2048
Classification Level Classification E-value
Superfamily YWTD domain 1.22e-27
Family YWTD domain 0.00023
Further Details:      
 
Domain Number 5 Region: 2427-2686
Classification Level Classification E-value
Superfamily YWTD domain 2.22e-27
Family YWTD domain 0.00026
Further Details:      
 
Domain Number 6 Region: 3729-4012
Classification Level Classification E-value
Superfamily YWTD domain 2.22e-26
Family YWTD domain 0.0003
Further Details:      
 
Domain Number 7 Region: 773-977
Classification Level Classification E-value
Superfamily YWTD domain 2.22e-26
Family YWTD domain 0.0018
Further Details:      
 
Domain Number 8 Region: 2766-2932
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000267
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 9 Region: 1069-1105
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000432
Family LDL receptor-like module 0.00087
Further Details:      
 
Domain Number 10 Region: 1213-1253
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000497
Family LDL receptor-like module 0.00066
Further Details:      
 
Domain Number 11 Region: 3111-3151
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000038
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 12 Region: 3075-3111
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000072
Family LDL receptor-like module 0.00054
Further Details:      
 
Domain Number 13 Region: 3503-3541
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000118
Family LDL receptor-like module 0.00077
Further Details:      
 
Domain Number 14 Region: 3161-3197
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 15 Region: 3593-3629
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000236
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 16 Region: 229-269
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000249
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 17 Region: 3296-3331
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000301
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 18 Region: 1177-1215
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000038
Family LDL receptor-like module 0.00074
Further Details:      
 
Domain Number 19 Region: 1254-1296
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000406
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 20 Region: 3421-3457
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000406
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 21 Region: 61-98
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000511
Family LDL receptor-like module 0.00077
Further Details:      
 
Domain Number 22 Region: 272-309
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000072
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 23 Region: 3253-3291
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000301
Family LDL receptor-like module 0.00087
Further Details:      
 
Domain Number 24 Region: 2986-3015
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000055
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 25 Region: 191-228
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000982
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 26 Region: 3460-3496
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000301
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 27 Region: 102-149
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000301
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 28 Region: 1133-1168
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000301
Family LDL receptor-like module 0.00089
Further Details:      
 
Domain Number 29 Region: 2930-2970
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000432
Family LDL receptor-like module 0.00095
Further Details:      
 
Domain Number 30 Region: 3376-3415
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000497
Family LDL receptor-like module 0.00095
Further Details:      
 
Domain Number 31 Region: 3337-3373
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000089
Family LDL receptor-like module 0.0027
Further Details:      
 
Domain Number 32 Region: 3019-3068
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000288
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 33 Region: 1357-1392
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000301
Family LDL receptor-like module 0.0039
Further Details:      
 
Domain Number 34 Region: 3677-3707
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000379
Family EGF-type module 0.0092
Further Details:      
 
Domain Number 35 Region: 3201-3244
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000019
Family EGF-type module 0.0068
Further Details:      
 
Domain Number 36 Region: 1439-1476
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000243
Family EGF-type module 0.013
Further Details:      
 
Domain Number 37 Region: 3642-3687
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000268
Family EGF-type module 0.013
Further Details:      
 
Domain Number 38 Region: 152-185
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000038
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 39 Region: 2081-2123
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000762
Family EGF-type module 0.019
Further Details:      
 
Weak hits

Sequence:  Bm1_13930
Domain Number - Region: 1302-1344
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000258
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number - Region: 3545-3586
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000497
Family LDL receptor-like module 0.0028
Further Details:      
 
Domain Number - Region: 318-360
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00134
Family EGF-type module 0.021
Further Details:      
 
Domain Number - Region: 1401-1444
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00379
Family EGF-type module 0.023
Further Details:      
 
Domain Number - Region: 1750-1794
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00796
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 4028-4048
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0998
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1_13930
Sequence length 4067
Comment | Brugia malayi Low-density lipoprotein receptor-related
Sequence
proteinXputativeXXXXXaaXMRFNLQIITFLEMDSPISPVEVPLSGXVSTSVHSGT
TGCSTNDFRCNDGKCIRFEWKCDGSGDCSDGEDEKDCPHPGCKPDQWQCDKYEWRSVSCI
PEYQRCDNITDCADGSDEVDCPAPSVSCNVNDGSVFQCADGRQCFDISKKCDGKYDCRDL
SDEKDSCPHNHTACFQYQFRCADQSQCIQKSWVCDGSSDCADSSDEPSTCEFKQCSGGEF
QCKNKRCQPRKFRCDYYDDCGDNSDEEGCGQYLCPPQQWNCPGSGHCIHKTKLCDGKNDC
LDGFDEKNCSSNLCPSLGCQAGCHSSPSGGVCTCPVGYKLDERFHRTCSDINECIEWGYC
DQGCQNHRPGFTCSCLGECYHLEMMHGPGNDNRTLRGYCLSRDSNTMRLYIARREGLYRI
NPNDPNEEAKKLVSGEFIYGIGFDFGDKKMFWTDRLSHSAFSADIDDSGDINNIKKLDLK
NLIFPRNLAVDWLTNHLYIVESGSRRIDISTFDGERXTVLIADGLVLPLDIALDPIRGEM
FFSNQFKLESAAMDGTRRRTLVDSHTHQVSGVVVDIAAKRIYWVDPKVDRVESIDYNGKD
RRIVIQGMNNVPHPFGLTIFDQYLYWTDWTRLGVMRVEKFGSPTDIIWTKKENNVFPMGI
VAYHPMTQPGPQQSDCLGLKIDNPCVEADCQGMCILSKDTGGLGIGYRCICPIGQKLIDG
KRCVDSTDYLLFSSNKVVRGIFPEIDQDSLSEAILPISPVSQRRIGMYFEVECDIHDNSF
FYADIMDNTVYRVKPDGEGSAPVLVTHNDGLVSMSFDWLSKQLYYVDNIRNSLEVVKISE
QGLVHPDQLIHRQLLNGLRDPVAVAVHPWRGILFFAEAQRPARIYRCMIDASNCHIIRNT
TLGRPSSMVIDFSEDRLCYGDTLLKTINCMNFDGSNPYVIPVDNPIPVAIAVLGDELYYV
HQRPYSIRRVNKRNGGKGRIIRQFTGKDRSVFSLKACSPANQPIPDPSIEHPCHSSDCSQ
FCFGLPNSSSSSEAQPLVKRCGCRQGFKINPENMRTCQRDRREIVEVLCASNSSQFLCAN
GRCIPNEWKCDGENDCLDGSDEVSFIAYHYQYCDMDVDDKKGSDDKPCFVEKECPPNTIR
CNNTKKCIPQQYACDGDNDCGDYSDEDVKYCKNGEIPVCAARKFQCDNHRCIPEQWKCDS
DNDCGDGSDEKLEMCSNTTCSSNQFTCGNGRCIPVYWLCDGDNDCYDNTDEDKERCPSAL
CRPDQFRCANKRQCISLKNHCDGQQDCDDGSDEDSCFSQSDKCTHNEFTCASDGLCIPIA
WKCDGQKTWLCDGENDCGDNSDEDAEHGCQRSQLLSIRCPFEHMACPGSPDICIPFHNLC
DGKDHCPGGTDEGGRCARDLCAADRAGCAFKCHMSPDGPLCSCPFGEALVNKTKCEPENE
CLDARSCSQNCTDEKHGFTCSCEEGYTLDADKRTCKVTDGVQDMRIYVSNRNRIYWSDRF
LENWHTFEARVENAIALAWDSVEDRIYWSDIREKKIYSATRNGTNVTVFISEGLDVTEGI
ALDWIARNLYWVDSSLNTIEVASLERSSARAVLIHENVDQPRGIAVDPRKGLLFWTDWGQ
NPRIERANMDGSERRVLVNSKIYWPNTIALDLTTNRLYFADSKLDYIDFVNYDGNGRTQV
LSSTKFVQHPHALAIFEDIIYYSDRRLQRLQLYPKYPNGTSTEYQSHTFSKALGVTAVHP
VLQPHFENPCATNHCSDLCLIGKDMKSTCKCPLGKILDTSGKNCISDMKPFLMLIQKTNI
FGLSMDDAVNGTPSLSGMIPLAGLSNAYDADYDPESAEIFYLEHATTGRIISPNSLPESR
IIQVVPSATNRTQIIASQIPDDSYAMAMDWIGQNMYVANKISQTIEVVRTKDMQYRATVL
NNNQSPTAVANPVALAIDSDRGLLFWLDRGSGAISPKVARADLDGKNALVIVSNELTELN
HLALDTINQRLYFSESKAGRISYVTYDGQDRHYILNDVGKQPRGIAFFNNRLFYADSAFD
SIEVTTLSSDGQLSQFQHFKKNIDQLINIKAISGRSAEHSHPCRTNNGNCEHLCIPKAFS
QHYCMCATGYVLESATHCRLFDQSFLIVATKTQITGIPLKEEQKRSVAMEPIGGTSIAAV
DYEFESKSLFVAETSGANRGIYKVILGSGEVKNIVRDNFGSFTVRSIALDWINYNLYFIN
VDSDRTHIEVCQLDGKHRKILLSTKTETPTSLAVDPIGRYLYWADQGQKPSIQRAYLDGS
HRQVIVHENIAEPTDLTIDSNSHMIYWTDAKLDGIYRVRADGGPVELVRSDIAAAAGIAL
LGQTMYWTDNRLEKVFSASSSPNQTSLLLSPTTIAAGLTDLGNVVEDSMRPTFVLPSPGS
QSPLCACARGVLKGRSCEEPETFLMFADSNYIVDTPIEPDVKAPNPLKEALPQIENLQTF
DVDVNLRRIYMVTESANGANISWFTINQPTKRRLIFGPTKSKIADSVRHISDMKLDWLTH
KLYFTTGRGGKVYVINVQGEHAATIANGDWTYALALDPCAGFVFWSDSGYKITGGIYEPR
IERANMAGGDRRVILKEGISLPAALAIDFREQRLYWADINKLNIESSDYDGRNRRTVGIG
YRAKSLDIWGHWLYMSDPLANGIFRMNKNSGIDYQNVVSDRRIPSTLRVIASEADTRTRN
QFCSTYTSGLCKKDNGGCEQLCHVIASSGETIASKVQCACNDSFELVTEPGKDIATQCVP
RETVQTCQPPYNFQCGDGICIALSATCNGKHDCADGSDEHPTYCNTRVCPEPYFLCSNRR
CIEAELRCNNLDDCGDNSDELDCITTSTTCPSGHFECSNGHCINSTKVCDGHNDCHDEKV
SDENKETCPNLPIDCRGVRLRCPNTNICIQPADLCDGYNDXGDKADENKLFCMNQPCAMH
YVRCPSGRCIPETWQCDGDNDCGEGAWDENHTNCTDSSGKRICLGEYLFQCDNGKCISRA
FICDGEDDCGDASDESIIHNCGNRTCTEQEFHCKSNVHLSQPKYECIPKAWLCDGDVTCA
NGEDESKELCGVEKKQCNKGEFRCANKHCIHASWECDGDNDCLDGSDEHPNCTYSQCQPE
FWQCSNNKCIPNSWKCDGNDDCDDGSDEKDCTDKSASALIANSCSIGQFRCSSGECIAEM
KVCDRIYDCLDRSDESSKCFINECTTAEKPLCEQKCVDLPIDYRCDCFEGFALDKDDKKS
CHDIDECEKCDKPCDPWMFKCSATGKCIPKRFICDGDDDCGDRSDEADAICKNKERNCTA
EEFRCSNHKCIPKMWKCDNDDDCGDGSDEPSECSSIECRKGWTRCSSSYRCIPNWAFCNG
QDDCRDNSDEIRDRCPTCDDIGEFRCATSGKCIPKRWMCDSENDCGDDSDETDPSCGGTS
RPCSESEFRCTDGRCIPGNKVCDGTLQCGDGIDESQCKLRDCNQGFMKCDDGTCIPEHRW
CDRRRDCPNASDESHCENYPNRRECSPFEFECGNSVCIPRKFICDGDNDCGDNSDETNEH
CKXALCDPPLRFRCAHSRLCLNILQLCNGVNDCGQFDHSDEHLSMCSSFSEYGDCTTNQF
KCTNGKCINASLACDHNDDCGDASDEIGCAKRKGITCETNNENGNCKHLCTDVKDGYYCH
CRDGFQPNPVDPYDCIDIDECMGNNTCTQICMNTKGSYLCRCLEDYENNVVVGAMTGKDC
RAKSDPPLIMIAADGEVVQLNPAHAGETNRHAAGMLDQNDIIAVDFDPRRELMFWIDSEK
RKVYRSALPKGNQSHAGQELNIDFKDLKSSPSALSIDYLTGNVYLAAISDDEAAGFIVRK
KRETEQTINKGSGGTIYLAKSDGRYLRTLIKGRLHIPTAIITLPQIGRICFADAGFDAKI
ECADMDGKHRNVIVKDLIYSPTSLAVDEGKDNRIYWADPKYRKVESVLPDGTKRTTVIID
NRMPWAVDVFENNLYWASKESQDLFVQDKFGRGRISVLASNIPNAHSIRIHQRFARDTSR
AVSTXAEATCSHLCAELPRNTYTCLCPDESPQLDVSLKYIFNEEKKD
Download sequence
Identical sequences Bm1_13930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]