SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_14940 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Bm1_14940
Domain Number - Region: 15-52
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.095
Family SPRY domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1_14940
Sequence length 74
Comment | Brugia malayi RE37682p, putative (75 aa)
Sequence
MGHWISDTGVAFDHVELKFYKNGVLLPLSISNVXGQVYPIIYVGDNAILDVAFRSFSYNA
PVGYEEIMLEQTIL
Download sequence
Identical sequences Bm1_14940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]