SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_16965 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_16965
Domain Number 1 Region: 91-270
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 1.21e-32
Family AlkB-like 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm1_16965
Sequence length 297
Comment | Brugia malayi LD42289p, putative (298 aa)
Sequence
MMVQSVXTEPVEEEKPKCGCKGVRFXAACKDTLRVKKLRLCEEYPFAKYKKYVYSSHHHI
AIHDNSLPNRPSLADIHDVASRINKAENNFEDDLAVPGLYVVIDFLSEAEEVDLVNAIDK
TDWVLSQSGRRKQDYGPRINFKHKKIKMDRFFGMPSYTDVILNRMNSISSDLFGSYHPFE
LCNLEYRDSRWSTIEMHYDDTWIWGERLICINLLTKSVLTYANDEKQLIIYVPLPSRTMV
CMSDEIRYSWRHAVFPEHIRGRRIALTMREPSTAFKEGGELYEKFGRELTRLGNIRI
Download sequence
Identical sequences Bm1_16965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]