SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_17150 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_17150
Domain Number 1 Region: 205-345
Classification Level Classification E-value
Superfamily PH domain-like 2.98e-28
Family Third domain of FERM 0.00019
Further Details:      
 
Domain Number 2 Region: 102-206
Classification Level Classification E-value
Superfamily Second domain of FERM 3.93e-27
Family Second domain of FERM 0.0000506
Further Details:      
 
Domain Number 3 Region: 22-100
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.58e-22
Family First domain of FERM 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1_17150
Sequence length 2268
Comment | Brugia malayi conserved hypothetical protein (2269 aa)
Sequence
MGKKISXGELCDIQQAMGQQPATVQFLDSTSHIFYVSKKAEGGELFDKVCAFLDLTEKDY
FGLCFADGDGNQQWIYDDKRISKQLKGHPWDFHFKVKFYPPEPATLAEDKTRHLLTLQVR
HDISTGRLPATLATHALLGSYVAQSVRGDYEPSLQYIDFLRNCHLAPIPNEILYEKVEEL
HKNHKGETSAEAELHYLENVKKLSMYGVQLFHAKDGKSTPVQIGISAHGINIYLDQIRVH
RFLWQNIIKIGYRRNIFIIKVKPGELEKNESTAAFKLHDYEAAKRVWKCGVEHHTFFRLI
QPEEKPHRGLFRWGSARFRYQGRTQFQSKMASQMFCNNQPIQRSQSVRVAQNDENVAIPA
SLSHTLPLVYSENGAGRKLDWNDSQIISPEKIYSTHIVEATQNREKDAILNDAEVGNTNN
TSGKLFDSVHSSAISTTANTAIATDSTVTGQYFEQSLSPHISSHSTKITHDTIPSMHKIM
NDHVHCQTNNSYESSKSDIYAMRKGNMGFLPVEDKAVIYHPGHYEEEMIGSKQLHEPPVE
PGDDFVLVHKPKLGSTGKIFHRDGTETNILIKEEDIEAYPIHRFADIYHSGFSRITSGNK
ENLKAFKNEKILETDDIVDKPKVNKEKYPTSGQFKGPILHTERSMELPAEPXRSHTYVYN
KGYYDSIDSSRKDIDENEKGNIRNWLRCYKKSEKSQAKLLKEKDAEIKGKKLINGDHTIC
KSETENEQENKAKEVPLIHVKQPGYERQAVQTSYYNVESSEKNQGTKYLKKSKVVAVGAK
DDKSFDNDIKEEACESMQPKQICHLFIGTSDSSHIRPGAYGVPSTSYDELLHIIKCEEEL
PFLPIHEHVMIYHPGISVIKDKKRRKFLIGKERKKTTSSGTSTDEEMQSNKGEKCKAILD
ISEADKNDLAVIVDDAEKRPIDEGIKRKCMMHEMKEKDQKKVDVTSDSVVQKITVKKDMK
LADSQNVKNGSTRQKMKAIFHRSEDQNKLRNLKKETAVPKKPKESNDVEQKIQPAYNILG
GIGKSVKMSKRTELLEQSQDNTPPPLKLSRISEISFQPLHLAVKVQNQMQNLSHNYRTFK
RAKHKGDVEFIAKENINPESYKRECTPYQGPLESTNYVRGLQFAPIHEYSAVYHPGHTYV
KSSCKVNKRRNTAECQNQEKSSILKTKKIAALNLNTKNSYSKHHEEEKSDNESKNDDQVT
AYSAKIICKTPLEERRKVKKYSFKYRRISGDVEIVEKPFVKPETYNLXTISYDTPLSCLE
CEKELSFTPLQQCVALYHSGFSHKKAKRLRDSSTESSSNTSFSSSSSTSSTYVSEKTKEL
KKKVMLHLISKKHNTNDVTVESSKHKRIFPFWRKTIHSEKEGKFADDKKEKLDISSKFHX
IQHQQQSNVSVDCTASQTTSSPSQIITTVLKKDPVEKTDTSLHVKNENKKLNTNLYKKEP
LGTSEYDEDNGKRGKFGLFHFWRSTDKENNSKKFNSSIADMNNYSNEEPMNXXTNLDSFH
RETNIRLTTKGKKKPITYIIEKDISTTDVKTNELAPSINMKDDSLNHTSSSDQANIEMKK
NTFIXLKCDTELADNSPLNSNSNAGIVTLTGISSPRTNEDSKSSNTEKSQLMDKENNIHS
CESIDDSNENNLKKHGKRDYVGYIAKVKVKQEMRNVDENLQQSSNLRAKEINTSDNGVNK
RPSFIKLVELQKFTDSANNKPIVRKEVAESKVKKKSTGSDVTLKENKKDNGKNIKGNFFS
SFWRGNKSDEHQKQQKVVERNVHETEVTPVEMTSPSNELEYNILRTKTTVHSIKPSSDIT
HVEQQTRQKDFVPVYDFSFVPSFPDDTKLATETTVSNVKKQIGLIQDSNDGIVTDKTTSE
TGEQRDGKLRELLSYRSKDMEECNDXLASSEDQNDNLREEQSTVNIAKQTSMEKTFVTEL
SWEKLNTETEIELETFEAEKLFHRSGISAGEALDEPFKFTQTPPDIPVLEAHSTDLRRPG
GFVEQIERQVMQVITKTSPSSDIEKSKKEKKTSASXRESENFNASEIEIVSHDSHADKSD
FTGELLPEEAKLDDRLVELDVDVVPAIHPTNIDVSLPYTCVEMWQETMNXPKTVVTTVDH
QGNITKKTIKKQQMTHTMHQQXYQASNASSQNGDFDISVIDASKKLFALNGNENMTSLQA
PIVETVDNKLTCEPANDIDKINGNDYSDIPGELVSSHTVTQGNRTIETITYKTEKNGTVE
THVEHRVTIHSCDDIDHDAELTQAILEATNMNPDMTVEKIEVKHESQC
Download sequence
Identical sequences Bm1_17150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]