SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_17350 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_17350
Domain Number 1 Region: 32-102
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000000565
Family Caspase recruitment domain, CARD 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm1_17350
Sequence length 113
Comment | Brugia malayi hypothetical protein (114 aa)
Sequence
MSADSQTLPCSRPLADSRIEQSYHLDQLRSKLARLDMRDLVPQLVARQVLRSQEMSAVYS
EEKREDQVDKLIEILKTKNHWLGPLIDALIRNGQATLAKELLAINNTKTNKST
Download sequence
Identical sequences A0A0I9N5P6 A0A0R3R916
Bm7324 Bm1_17350 XP_001894927.1.25112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]