SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_18465 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_18465
Domain Number 1 Region: 221-355
Classification Level Classification E-value
Superfamily PH domain-like 7.38e-34
Family Third domain of FERM 0.0000379
Further Details:      
 
Domain Number 2 Region: 115-220
Classification Level Classification E-value
Superfamily Second domain of FERM 1.57e-28
Family Second domain of FERM 0.0000281
Further Details:      
 
Domain Number 3 Region: 26-113
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.47e-23
Family First domain of FERM 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm1_18465
Sequence length 457
Comment | Brugia malayi neurofibromatosis homolog protein 1, isoform b,
Sequence
putativeXXXXaaXMGFFSPGGSWKYLSVKVSTMDADLEKITVEPDCTGRQLFDTVCRI
IGLREIWFFGLQFVNKKGIPCWLQMDKKIXKQEVPKQEDGSMHLIFLVKFYPEDVEEELI
QDITRHLFFLQIKQSIXSMQLYCSAEASVLLASYAVQAIQGDCVESSKLQLSELLPECVI
KQYDMTPQMWEERIKRWWINNSGQSREDAEMEYLRVAQDLEMYGIQYYPICNNKETDLTL
GVSAQGIGIYKESNRITPRPFFSWSEIKNISFKNKVFNMRTMDKSTITFRAKDISINMSI
LDLCVGTHNLYLRRRQPDLLEVQQMKAQAKEQRIRRIQEQNRLSREREQRIQAEAERDRY
KNEIAAINEQLRNMKEAMKKTEENAHLMAEKARVSEEEALVLSKRASEAEAECQRMKLSQ
IKVEAQIYTFFWSSKLCLCYGWSKGLKMGGGVYLKNL
Download sequence
Identical sequences Bm1_18465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]