SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_20780 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_20780
Domain Number 1 Region: 155-398
Classification Level Classification E-value
Superfamily vWA-like 2.72e-73
Family Integrin A (or I) domain 0.000000387
Further Details:      
 
Domain Number 2 Region: 408-484
Classification Level Classification E-value
Superfamily Integrin domains 4.08e-21
Family Integrin domains 0.00086
Further Details:      
 
Domain Number 3 Region: 660-742
Classification Level Classification E-value
Superfamily Integrin beta tail domain 7.19e-17
Family Integrin beta tail domain 0.001
Further Details:      
 
Domain Number 4 Region: 53-103
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000068
Family Plexin repeat 0.0023
Further Details:      
 
Domain Number 5 Region: 571-609
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000753
Family Integrin beta EGF-like domains 0.014
Further Details:      
 
Domain Number 6 Region: 614-658
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000128
Family Integrin beta EGF-like domains 0.006
Further Details:      
 
Weak hits

Sequence:  Bm1_20780
Domain Number - Region: 536-562
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0153
Family Integrin beta EGF-like domains 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm1_20780
Sequence length 820
Comment | Brugia malayi Integrin beta pat-3 precursor, putative (821 aa)
Sequence
MRDRWLTRLGWCRXICLSTTIFIVGAQEFTTDDATSEIVESKKDFPCYSLPRENYTCSAC
IQFHDTCAWCSKADFDNENQHPRCDSLERLIEHGCPEFEIENPKTTVRTTENVELSNAGD
AASEEEAVQLRPQHMVVNIRPKARVRFQVTYRQAVDYPVDLYYLMDLSYSMKDDKQKLSE
LGDLLAERMKAITKNFRLGFGSFIDKKLMPFVDPRPEKQLSPCPEQCAQPYGFKNQMSLT
MDTNRFSKEVEEAEISGNLDAPEGGFDAVLQALTCNNSIGWRERARKMIVFSTDAGFHYA
GDGRMAGVVVPNDGQCHLDSQGYYTKSLDQDYPSVALLHQKIKERKANLIFAVTEKNKDL
YKQLSDALPDVSSSVGVLADDSRNIVSLIEEEYNKISQKIIMVDNANASQGLRLSYRSRC
LDGHTLKETNVCDGIKVGDEVSFEVTLEATHCVKERDFNLKIGPSGLDETLQVDVHVQCD
CDCETDRVVYNSPICHGKGDLVCGVCICHGTNVGRHCECDAPGLSTVALDAKCKRTNESA
ICEGRGVCNCGVCECFERDNMNEKISGQFCECDNFNCPRHDRKICAGHGTCDCGQCTCKP
GWTGRACECPLSLDSCMAANGKVCNGQGECICGRCRCFSDGPGNRYSGPKCEICPTCPSK
CVEHKPCVMCQQWQTGPYNETQCDECTFTVIPVKELPVLNDTTECQFVDPSDDCTFYFLY
YEDQRTDNLTVWVKEEKDCPPPVPVLAIVLGVIAGIVILGLILLLVWKLLTVLHDRAEFA
KFDSERLLAKWDTNENPIYKQATTTFKNPVYVGNNTMKNK
Download sequence
Identical sequences Bm1_20780 XP_001895610.1.25112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]