SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_21790 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Bm1_21790
Domain Number - Region: 7-35
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0281
Family PHD domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm1_21790
Sequence length 123
Comment | Brugia malayi hypothetical protein (124 aa)
Sequence
MDYSYRFTHSDCDSDSLNANTIETEYVCPTCRNSPLVADAMMISAGNSSVAASPTSISTH
DEASRSIPLDNPYCMDSPNRSSPLMSLSQLDTFGDFFNIHQSTGSSLQLELISAVHNAKL
LPD
Download sequence
Identical sequences A8PCC1
Bm1_21790 XP_001895812.1.25112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]