SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_30650 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_30650
Domain Number 1 Region: 105-249
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.71e-34
Family Ankyrin repeat 0.00025
Further Details:      
 
Weak hits

Sequence:  Bm1_30650
Domain Number - Region: 48-120
Classification Level Classification E-value
Superfamily Cytochromes 0.0906
Family Cytochrome c'-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm1_30650
Sequence length 264
Comment | Brugia malayi Ankyrin repeat containing protein, putative (265 aa)
Sequence
MVDSENEEPMEIHSSTVTTDYEHNRPGSSMSTATSSTLCQSFEDFDGNNAAEMEDTIPSV
IDFTRQSKLMAKIRDNKRKLPSRWDDDDDDGILAKDMNDPKEQVLTAAEDGNLESLKDLI
ENNPSLLSARDVDGYTALHRAAYSGHTDIVGYLLSIGANPEWNTNDGWTVLHCAATWSMC
EVVALLLRHGVDVNSRSHGNLTPLHLAITSNQSEDRVLTTVRYLLEAPGIDAAAVSNSGD
SPLRVAERTSAKITEMLMRYFSKP
Download sequence
Identical sequences A0A0H5S6X3
XP_001897569.1.25112 Bm1_30650 Bm3630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]