SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_30980 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_30980
Domain Number 1 Region: 16-102
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000207
Family First domain of FERM 0.0056
Further Details:      
 
Domain Number 2 Region: 104-211
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000000262
Family Second domain of FERM 0.0058
Further Details:      
 
Domain Number 3 Region: 216-277
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000523
Family Third domain of FERM 0.0041
Further Details:      
 
Weak hits

Sequence:  Bm1_30980
Domain Number - Region: 495-563
Classification Level Classification E-value
Superfamily HR1 repeat 0.0262
Family HR1 repeat 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1_30980
Sequence length 1085
Comment | Brugia malayi GRP1 binding protein, putative (1086 aa)
Sequence
MGRFQRLSMHDGKRSIIYLLDGQQLELTIQPRLFVHELLNIIASHVALKDADKKYFGLAY
VDHLEQYHWLPTDRRVLEYEIPRKSHQLHAVLELHHSVKFFVDSVLTLCHPSAIELYFLE
TAKRLVKGLLEFTDLEYYKIASSFLQIYCGNYVSDEKARCSLTELIPIPNGILHAYHISL
EDVEKNVIEMYKDLTGVPKGVAILNFLQTAERSSTHGCHFYQVRDKAGQPWTVGISNKGI
FQYDPADISKPKKIFNWSLLDNLYYRDRKFSIEVRNTRVIQSSGSANSILDSTGYLDSDD
ELAKAVRDPTTHLHKRTHTIPFRIALYRTLQWMVLIQRDFAGPQSTTFTHTRKQARIVSN
DPGVELKQLGEKLCRLISHSSVASSLPSLNSLSSNGMPSAKVSDGSLVSLSSLNDIQNRE
KTEEEKQKEVEMYRRLKKRKNELEEKLLAKLDELRELCIKEAEITGELPKEIYKTLMPGE
EEPKVKRRVGTSFSLSEEVFKRPNDRISMLEADVELHRKIVAAAERLAKDKTTNKSVRKK
RQKDLIAATQKLRGLEFGLTQLRLSASKPDVSSSVRNIPGSKGPWRNCSDYQIESTSLGT
RNDSNSLITKSCPATPRGSFPDLLNSAENERREASDDNNNNNNNGDDDGKRRASMECVQR
YPSTSTCSSIHSAHISNNTSSFTGVSESGLSFGNSPFDSRTSKRIPPPLHRTCYFLPERE
ISWEKLKNKNTENHHIPIYENVGYKSCVSYKSSYREMNFPTLNDHSDCKGRFERAFLDHD
LPEQESFAKSDDKYESRINYSVIGCSGSSKNIANYGTALKQPSWKDYFAQENNRDLCIVG
VGKNNNTSQQAMIQQQQQNDETPSSSYLRRKLVNSSLETYQNSGCSSPPVAGLLLNDGKT
PLRYAVLPTSRSYNDGFTTASLDRRAMKERQSSCSSMGYQQLRSAQLAVTDMVREVCIGQ
PVTRRTPLSTPRFTTTFPVSGPSIENSKPVLSADTHHYQQRSPLQQCNTLEHSMTSLRNV
AQIIGSSSILRPPPPAYPVAIRNGIIGVRNPLGKVTTAPTELRMDTLKNYYKDKTNGIKK
NATAV
Download sequence
Identical sequences XP_001897639.1.25112 Bm1_30980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]