SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_31895 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_31895
Domain Number 1 Region: 112-218
Classification Level Classification E-value
Superfamily Second domain of FERM 2.22e-27
Family Second domain of FERM 0.00013
Further Details:      
 
Domain Number 2 Region: 26-112
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.23e-25
Family First domain of FERM 0.0016
Further Details:      
 
Domain Number 3 Region: 227-306
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000141
Family Third domain of FERM 0.0093
Further Details:      
 
Weak hits

Sequence:  Bm1_31895
Domain Number - Region: 1145-1155
Classification Level Classification E-value
Superfamily N-terminal domain of adenylylcyclase associated protein, CAP 0.0379
Family N-terminal domain of adenylylcyclase associated protein, CAP 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1_31895
Sequence length 1225
Comment | Brugia malayi FERM domain (1226 aa)
Sequence
MGGPGSGMIPKGVGAPPPPGMDHRRGKLMCIKVRMLDDSVGVFHLGHKALGQALFDEVCR
HLNLLECDYFGLEFTDCYGNRCWLDKDKPILRQITTTHSDARFYFIVKFYTPNPADLVEE
YTRYLFALQIKRDLAMGELLCNENTAALLVSYIVQSDCGDFAAEDYPDDSYLSSARFIPN
QNTEFQRKVMENHMKLIGMSPGESDLTLLETARRCDYYGVKLHAAKQYYKETIEFLFETR
NECKNFWKKCVEHHTFFRCIEVLPVKKTREGRFFSKGSAFRYQGRTQKQLIDYTREHRKR
REPFTRPIKSGLSSSSNGRFSRPAFFDMTHPAYATVSERSVNLIGSGTLPSRNAPVYCMN
GERSMNRGSCVSNQSHSRGTGQQLMTTGTMSYFPGEITLKNYSTTIGTRNHRHRNSQNYP
SNSSAAAVNSERMCLSDMESNDLCSLAGGSITNSRYRQQQHSEFKPLKQSTVKSVKAGAV
AVTSKTNNIANASDNDAITSVSLPNVLGDDVQIVCREFELKCECPPKSASGDNFLELHQP
PRDYDNISEGSYKLSDNELRSAHSDIQAVPVNPVYATTFTAKRVGNVIVKKVVSNTRSTP
NTTDDEDPHSERRLGSGGRKIEAGRNQQNISGQVYRQESSKSNQVEIDDADSQRRFYAER
KHSSSAPASYAEYPLHQKLIPIEIDGPNVNLDEHRKLSGRKEINRVSKVHGSTPPQIPVR
APITKIESDCWHITNEPQPSVSRTKELQPKHSKIVYTSKGTILQKPKIIPDEDDLSTSEN
IYSNVSFIHASDSGQSYMTIAQPQQAPKTYGAIGPLSGKVITKDNLVITPEGYRERKPKP
VVPPKPKNFVCTSEAGLIESTSVSRVPEIKPNHPVVNLQKETFPSCTTSSGIRELNRPTL
ISVQSEDYPEIQKCHLFNSDIPYVLTMRNISTEAEGSFSTFKDISTKSTVSEVLANTVES
SSQHRSLSGSRSPDSLRRRKSLDLVPKKRLPSPGNFSSQDHSLSPSTPESGDVLEYLLRR
RNVEKSAIAKRGRRGDPRRQTQPVRFNIPSNEKTERQQIGAISQPNLNDNDDEVKCVMEN
VERMTKDLKENERIYTNLNVNSDFKREMERSSETQKEKKEQSGSNEITTIIGNEFTDSAN
TDDFPPPPPPPPPPPSLPIVLKQSVPSEPITEACMQESVETLPYADESTSSRASCASKDE
TVDNKISSATSSTLRTPTGVLWTDF
Download sequence
Identical sequences Bm1_31895 XP_001897824.1.25112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]