SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_32010 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_32010
Domain Number 1 Region: 341-461
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.73e-17
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 2 Region: 172-301
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000518
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 3 Region: 32-174
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000188
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 4 Region: 297-342
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000481
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm1_32010
Sequence length 562
Comment | Brugia malayi Calcium binding EGF domain containing protein (563 aa)
Sequence
MLEKLVIGQNIETVYYRTYKNVTRTRRHTTAQCCTGWIQVPGKEGCQRASCTPELCHNGG
TCQPSTSDKSEEICRCLPGFQGTRCQYDINECLVENGGCPHDCVNTIGTFYCRCFAGYQL
DSDHKKCIDIDECQFENGGCEFRCLNTEGGYRCECPPRMQLHSNGRRCVRENICATDNGG
CEHICEERHGRFHRCKCRQGFKLASDKRRCHPIDPCAINRGGCEQHCVNDNGRAVCQCYH
GLRIGPDQKSCVDIDECATTKNSECQHECVNVYGTYRCRCRPGYRLLPDGRHCKPIIDPC
QDKNGGCEQICESNEDGSLKCSCKSGYQLISDDKSCSDIDECTDNNGGCKQLCINLPGSY
QCSCKTGFLLIYDGKTCEDINECIANNAGCEHNCINEEGGYACTCEVGYNLASDNHSCYD
INECLSNNGDCSQLCKNEEGSYHCKCFRGFSLAEDGKTCIASLLSDLLFAHLTTDSAPPS
IRQHARQVELLRLIDHSEYNDMMIRQQEHSEISIEDESIPQDLPKLSHFGAIRMLHSLPT
GCEYGRFGKDCRYRCVDCKNGG
Download sequence
Identical sequences XP_001897848.1.25112 Bm1_32010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]