SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_32380 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_32380
Domain Number 1 Region: 366-586
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.53e-51
Family DBL homology domain (DH-domain) 0.0002
Further Details:      
 
Domain Number 2 Region: 91-210
Classification Level Classification E-value
Superfamily BRCT domain 0.00000000000000305
Family DNA topoisomerase II binding protein 1, TopBP1 0.068
Further Details:      
 
Domain Number 3 Region: 229-313
Classification Level Classification E-value
Superfamily BRCT domain 0.0000000552
Family DNA ligase 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm1_32380
Sequence length 773
Comment | Brugia malayi RhoGEF domain containing protein (774 aa)
Sequence
MDGEGSVLSSEVAASLLSLEVTENFTDRENTVARSASQIRRVNRVCVVGVARSNTEVTDL
LKNHFGIELLESEDGYEFTKDTDITFLCSEFTDCRWFKYLNSCQKPIIGPAIIRKRAVDG
KPLLVPRPNRPLYTDTMSGVRIALSGLSTKNCREAVDLVHFMGGSAQRVFSASTTHLITD
AARGKTYRMAVSIGCRVMHLDWLRAAWAARNSIQISVTTIDFMNKYMVEPFCGLSLWFVA
YDEKDLTEMKEKTVENKGKVAANQKQATHIVVSTSLDAKVEGCDAKQHLVSGEWFWISVQ
LNCCANETIYKWKGQRTKQNSTLSPNTAELANRAGKSVSKSSMEVLDSSNCSALPDYSEH
LLSTDDSEILNSSPRKLNKRYAVCKEMLETEENYLRALKIVVQVFKEPLEAQLPNLDSGL
LTKAEISQIFAKIPPLIDVHENICRTLQSYIMHWMNERLIGKVWLDHAAELTPVYKAFIN
NYDTAIQTLNECDQSKPKFHAFLKAAESRMECQRNSLPDLLVRPVQRLHSVVLLLKAILE
KTDRKNPDNAYLIKAKRAVEAALTEANESRRQTDSYAMIFKLSSEIERCPADILSSARTL
KTELHVLSLGGEDEWAKTRNKRMAIFLFNDLIEIVKVRTGNDDSNTPTRRSFSNYSLTRQ
LSFSVLRHGKKKYKHHQQYMLASIRRIQSLVHPDINGVFVLSFRVSQGEDFWVAQCLENQ
EGELEKFLREVADQVYKLVGRNTLVEKVDFDEDPSSLGVKENITTIKKALNHA
Download sequence
Identical sequences Bm1_32380 XP_001897921.1.25112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]