SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_33480 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_33480
Domain Number 1 Region: 622-804
Classification Level Classification E-value
Superfamily Kelch motif 5.23e-48
Family Kelch motif 0.0000607
Further Details:      
 
Domain Number 2 Region: 100-152,190-252
Classification Level Classification E-value
Superfamily POZ domain 3.1e-24
Family BTB/POZ domain 0.01
Further Details:      
 
Domain Number 3 Region: 521-596
Classification Level Classification E-value
Superfamily Kelch motif 0.00000000000000955
Family Kelch motif 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm1_33480
Sequence length 816
Comment | Brugia malayi Kelch motif family protein (817 aa)
Sequence
MDDIHQPTNFGHCTVDDKRFSLLTSDNHTFLCQNNNNVNDNSDNNDDDDDDDDDDKNNDG
SNRNDGPFLEPKIPVRSTSLHASESDASMVIHSEEIMLKMFDNSMQDTLLSHLSTFRRNR
ELCDVVLFVHEKEILAHKIVLAACSPALMDMFVRSENGDRSSKRVSTTMLSTAGTASPPL
TTALALPITTQPFSYYEFAEADYDCFEAIVNYAYSSHLEISSRKVGELYKTACALQVTPI
ARACARYLIENLNITDCIGIRRQANINDDVLVEQVDNFIAKNFAQIVDENPGFTHLPLIK
VRLILSSDDIKKLCCGEDIALRVVQYFQSLPHINDRIEQWIEQLVEKTHMLYTDTDCRLQ
DCLGMDDRSSVGASDIIQDYKRTGGYLPRTYSGSNVLEVQNPAHHITGATQVHLNSARLT
NTKLSSAESNSSLSSNAEPDDESYKLIAVHRTAGKNKKDFWITLAVFHRCLVALSIQLSE
AENVIKSRTTSQVVEPSPIFEIEQQQEIAEETVVRLVSSESSSRIPLPHMESPRCSVGGA
FINGKIIVCGGYDRGKCLESVEEYNLLKKNWRRLADMAQCRGRFDAAVVGSKVYAVAALL
LAIRKFHALANFKICAKLSNLDMSVKFLILCCAALDGLIYCIGGCCEQIVLSECERYNPE
LDEWASITPLRTARFQASCTSWHGLVIVCGGCNGWKCLDSVDAYSPKTGKWQRLASLKTA
RRGSAVAVVKDSLFVIGGHDGTHSLNSVEILDDPTGEWRSGPSLTIPRANVKATVASGDE
IYLLGGFDGTQFLSSIEVLNSGSNCKAGGIGSERQN
Download sequence
Identical sequences Bm1_33480 XP_001898141.1.25112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]