SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_35635 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_35635
Domain Number 1 Region: 86-366
Classification Level Classification E-value
Superfamily Kelch motif 1.11e-32
Family Kelch motif 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm1_35635
Sequence length 448
Comment | Brugia malayi Kelch motif family protein (448 aa)
Sequence
MFGGPPEGAQVTWNDKRLPYQIFDDDSREISPVVGHTMIEYKKSLIVWGGYYFEEDNEFR
YRSSTFLYILPAGLLTGCKDVKWILYHVPHGDVPPSISGACAVLCGCCIFIFGGYVRRST
PNNILEGQSSAMYVLDLVQERWSLVVTNDESLIPTPRDKMAGWCYRKKCYYFGGYGPGPF
DMPNPALYLRDVGEFVADETRPFYWNNQLLIFDPDPTKQLNWTLAKVGGTVPSARAASAC
TFLERFNAILLFGGRSQNQRLNDLYLLDLSSLIWTQIDVTGINEPEGRTWCSLNTLFPNQ
ALVYGGYSNGARALSDFWRIEVQKDSVGRYLGTWTAVNIELETKSCRLWHTAAIVDGQLF
VCGGTDALLEEHIKIKGVLKKRMEPLPLSTICLGVLFPVVSEVNMLPAPFQLRFAWARYV
LSRGYQALHLGTEYFKKYKLLEILEMCX
Download sequence
Identical sequences Bm1_35635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]