SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_35930 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_35930
Domain Number 1 Region: 394-600
Classification Level Classification E-value
Superfamily Kelch motif 4.97e-59
Family Kelch motif 0.0000079
Further Details:      
 
Domain Number 2 Region: 42-161
Classification Level Classification E-value
Superfamily POZ domain 1.02e-36
Family BTB/POZ domain 0.0013
Further Details:      
 
Weak hits

Sequence:  Bm1_35930
Domain Number - Region: 328-421
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 0.0102
Family DPP6 N-terminal domain-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm1_35930
Sequence length 622
Comment | Brugia malayi Kelch-like protein X, putative (623 aa)
Sequence
MDENFFIGNVSPESTISQDHHHRHHQRVVPCSSSTLLCPPMMYRSQKHSRLALEQMNEMR
SDGSLCDVTLIVGTVRINAHRLLLASCSSYFRAMFTSEMAESRQQEIQMVDIEPRTLQGL
INFCYTGEITIADFNVQSILPAACLLQLGEVQEVCCEFLKKQLDATNCLGIRAFADTHAC
RDLMRIADKFTHHNFQDVAKSEEFISLPADQLINIISSEELNVRSEEVVFRAAMAWIRHD
LSNRRQFLPKVLEHIRLPLCPAKFLVSVVSEDPLIKIDAQCRDLVDEAKNYLLLPLERPN
MQGPRTRSRKPLRYGEVLYAVGGWCSGDAIASVERMDGRTGEWRCVAPMSKRRCGVGVAV
LDNLLYAVGGHDGQSYLNSVERYDPATNQWSSDIAPTSTCRTSVGVAVLGGLLYAIGGQD
GVCCLNVVERYDAHRNEWAEVAPMSTRRLGVSVSVLNGCLYAVGGSDGQNPLNTVERYDS
RINKWMTVKPMNTRRKHLGTAVHDGCLYAVGGRDNACELSSAEKYDPNTNEWVNVVAMNN
RRSGVGLAVVNDQLYAVGGFDGTTYLKTVEVYDRETNQWRQSGCMTYRRLGGGVGVVRLD
HDQYVPFSLDPDLTPFDDPPLM
Download sequence
Identical sequences A0A0H5S8H5
Bm1_35930 XP_001898633.1.25112 Bm5367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]