SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_37445 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_37445
Domain Number 1 Region: 861-994,1025-1195
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.2e-65
Family Protein kinases, catalytic subunit 0.00000271
Further Details:      
 
Domain Number 2 Region: 704-783
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000184
Family I set domains 0.013
Further Details:      
 
Domain Number 3 Region: 294-388
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000313
Family I set domains 0.065
Further Details:      
 
Domain Number 4 Region: 610-700
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000323
Family I set domains 0.042
Further Details:      
 
Domain Number 5 Region: 105-184
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000617
Family V set domains (antibody variable domain-like) 0.074
Further Details:      
 
Weak hits

Sequence:  Bm1_37445
Domain Number - Region: 403-490
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00221
Family I set domains 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm1_37445
Sequence length 1265
Comment | Brugia malayi Immunoglobulin I-set domain containing protein (1266 aa)
Sequence
MAVQCSNPWPFRFGSSKHEIYSRSLYTAPTTFSTKEHYHISFDYSLPTPHCRTSCWRFMH
LFYPFIRYLLIAVCFITIDASLYPPVIIGNKDFQEYKGQPYTEKKDGETLELNCSTTEAV
KWILPDNIFHTNFDPKERTGRVIESSFDIGFRSLRIEQLKSSDTGEYVCVAEHSGFSSSV
YVYVSSNKNGKSVRTGSFLNSGPLIISKELRGLNVILPCRTDKFIESGVELFINHIKQTG
EIQFDPRIGFIVDRGLLNDRAEVPVRCEYLGHTSEMIIVPIKNDKEMEYSPVIEVSNTWP
YVSQELNMNCTFHTRDGFRYMLTWKCPQCENETDRVVSNRYMKIGDGIKKLLFIRDLHES
DSGNYECIVTNRDDGHDVRRSTHRLQVSPTRGQLKVIDFSENIDSEEGKTVRLFHIARAF
PSDEYSSEWRKYSKTISSGEEFMEIIKKDIRSEVNADLHEDELSIINATVDDSAIYQLVI
RVSQDYIYRKNWTLSIRPIDIQPHITIHDQFGQLLVSDVLIDSKIIVTCLVKDTRSRKLR
LLYVTRGGEWEQPDDSKELSGFTFESAIKWITYAKEHMRIRCEDDETNKVDEKNLVVSEV
ETINASFIAKKPIDLLNEDNNIYEKDHLELICILPLNDDFDVVWMRDDVQLAYPERHVTI
YSQKFITTLDDISSNESGNYECIAKSKNTHIYRSYTLHIKINVVVAPHIVGTEEEYEHLA
KYGEKAELVCPIEGEPEPLYRWLKNGIEYNGYGSLTKKIDFPRVLVEDKATYTCVAKNRA
GSQQLVDEPAYIRSSKYWWTLGFATVSVLVLLLMALLFLLKQRCKSKRQEERLRALYNQL
MRESNGEYHDGSIGLKQPLHERVEQLPYDRRYEINKDKLFFKQSLGGGHFGQVYLGELSK
PRVSDSLAVSDVLKVAIKAPRDGRNVHHQKALADELKIMIAIGVHPNVLCLIGAVTKQMS
SGQLYMIMEYCENDNLKDYLSKNSAGFLNEVEISREPLSSDGYLSPTRNAQHKPQIYLAE
LKLQWAIEVDEERMADKMITTSDLISFGYQVANGMEYLSSKTCIHRDIAARNILVTKKRA
IRIADFGLARKDSTVYHIRSSQSVPLPLKWMALESILYHNFTEQSDVWSYGVLLWEIFSL
GKVPYPQIDNNDLLSYLLEENRMEQPKLAPDDIYNLMRQCWLSDPSNRPMFSECKVLMKT
HLSRASPPLSTRLDKILEEDQIMMEKYSEWRDSEEIEQDLRSQATRNGFIAIPTQEPQTN
SNIYM
Download sequence
Identical sequences XP_001898939.1.25112 Bm1_37445

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]