SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_38790 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Bm1_38790
Domain Number - Region: 7-96
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.068
Family Xylanase/endoglucanase 11/12 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm1_38790
Sequence length 111
Comment | Brugia malayi hypothetical protein (112 aa)
Sequence
MSTSSSTHQNAIQLDKFHATAQLPRPICLTVPIQSEQNQNVCVTIAMNNRGNAFYWFGAG
CGRQECFQHTAGKNVPNLTRNVQLDMTQEHQYCYTYVYALSTDVIQRQEPL
Download sequence
Identical sequences Bm1_38790 XP_001899211.1.25112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]