SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_39150 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_39150
Domain Number 1 Region: 92-277,368-446,572-675
Classification Level Classification E-value
Superfamily L domain-like 1.19e-58
Family Ngr ectodomain-like 0.00055
Further Details:      
 
Domain Number 2 Region: 939-1130
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.45e-33
Family Laminin G-like module 0.0037
Further Details:      
 
Domain Number 3 Region: 11-85
Classification Level Classification E-value
Superfamily L domain-like 0.00000000105
Family Ngr ectodomain-like 0.0083
Further Details:      
 
Domain Number 4 Region: 788-831
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000108
Family EGF-type module 0.0076
Further Details:      
 
Domain Number 5 Region: 870-915
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000367
Family EGF-type module 0.0093
Further Details:      
 
Domain Number 6 Region: 753-797
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000309
Family EGF-type module 0.012
Further Details:      
 
Domain Number 7 Region: 710-753
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000353
Family EGF-type module 0.012
Further Details:      
 
Domain Number 8 Region: 838-874
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000125
Family EGF-type module 0.012
Further Details:      
 
Domain Number 9 Region: 1134-1180
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000789
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1_39150
Sequence length 1255
Comment | Brugia malayi EGF-like domain containing protein (1256 aa)
Sequence
MSILFKFTVYSLDSHVIATWTEMEILTLSGNNLSTMGQLGPMPNLRILRLAENPWLCDCR
LRWMKKIISNSHLLARNTLCHRPAHLNSRMLENINETLMKCSGIEKRAATSCRDASVCPS
VCTCTETTIDCRDRGLTHIPANLPSTTTELRLEQNQITYVPPRAFHNLHQLKRLDLSKNN
IGNIGPRAFDGLKSLNSLVLYGNNISNLPSEAFHGLSNLQLLLLNANKLQCLRRDTFSNL
TNLNLLSLYDNQIHSIANGTFDGLINLTTLHLARNPIICDCNLNFVHYQEWLAHLLAKKA
IETSSARCDSPKRVAHRRISTLHHSKFRCKGSEAYITANAGRCIIDHPCPVGCLCLNTFV
DCSNQGWTDFPRKIPRYTTELRMSNNKIVAIRLSTNLHFENLTTLLLDGNEIEFIDSDSL
SALGKIQELDLSRNKLQHFSPRVFGSGNLQITKLSLDGNDFICNCHIVDFVYDLRMNGSH
LLNSAVCHEPLQLRGRTMASLTRDELFCTEVTEDTCAEDDNYCPADCKCHETVVRCSNKN
LKKFPVGIPAKTTELLLDSNDIVYIPPELNKLKHLVKLDLSHNRIVSIENEAFANLTKLS
TLILSYNKLECLGEEAFTHLTSLRILSLHGNDISVLPESAFANLHNITHIALGSNSLYCD
CRIAWFSRWIKRRFIEAGIARCELPLNLRNQLLLSANELQFKCTEKVPRNVLIKCDACID
SPCKNGGTCQRMKGRTFACKCAARYHGKYCQNKIDACYGEPCLNNATCKILQDGRFKCHC
VKGFEGDHCETNIDDCTFNKCQNGATCIDLINSYECKCPVTHIGRFCEVKMEFCSNKMNP
CENKGVCVRQALSYRCNCLPGFTGTNCTINIDDCEHNLCKNGAICVDGIQSYKCECISGY
TGRFCELSPMSSNYYPNTSPCHAHSCEHGVCHELGSDVFCKCSEGYTGKRCEQLRAAGYV
HDDSFIALEPFSASPDGNLTFTLITTASIGVVMYYGDNAHLSIELYNGRLKISFCVGNFP
ASHMYSYVTVHDGRPHRIEIYIKGITLTLKIDNHEPQTIVNSGPEEAFILISKNFLYVGG
IPTSVAIKAITAFHLKQPHSFKGCISDFYVNGVVVDFDKAEQKERVLNGCFKSVDLCSGV
QCYSGTCTTNSSLSNGYICHCPPGYSGTHCQRREIFCAKEKFHYHHVEGNCRSTEQIKNS
RCYGWCGSDSKQCCTVVKSKRRRLKMHCRDGSTTSQIVRIVRKCQCTAEAACRAT
Download sequence
Identical sequences Bm1_39150 XP_001899284.1.25112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]