SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_39465 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_39465
Domain Number 1 Region: 66-187
Classification Level Classification E-value
Superfamily PH domain-like 1.31e-26
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 
Domain Number 2 Region: 203-267
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.87e-19
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm1_39465
Sequence length 323
Comment | Brugia malayi Plekhf2 protein, putative (324 aa)
Sequence
MSKYWGCDRFKSELPEHEKGDVEKVGDSGEWSPPRCGMFADGVDYGFELYSGETAMVDRL
VNSEVNTRRILNVEACFGSTGQQLAAYGRVLVGEGVLVKMCRKKPKPRQFFLFNDILVYG
NILISKKRYNKQHVIPLEEVQLQDLDDEGDMRNGWLIKTRLKSFAVFAATSTEKKEWILH
IERCVHDILTRGGKKPATEHAAVWVPDGEATKCMACQRTQFTVIQRRHHCRACGNVVCGT
CSSHSYRIPVSKRPVRVCDSCFAKFVSKDSGHSNAVTSGPGILNDGSSDSDDEDKSVTYD
LQPTFYSRIGCGEEKKKCSSFVE
Download sequence
Identical sequences XP_001899347.1.25112 Bm1_39465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]