SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Bm1_39825 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_39825
Domain Number 1 Region: 71-208
Classification Level Classification E-value
Superfamily L domain-like 1.09e-29
Family Ngr ectodomain-like 0.019
Further Details:      
 
Domain Number 2 Region: 234-319
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000252
Family C1 set domains (antibody constant domain-like) 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm1_39825
Sequence length 663
Comment | Brugia malayi Leucine Rich Repeat family protein (664 aa)
Sequence
MKRFNKFTCLFAICAFELTVLIHCNWTRCSYLVDTAIVDCSGLNLDKIAQTAQLKAPTSE
FYPSTIGGQVYLLNLSGNAFRSINSSSFSSLRHPETLEILDISHNAVMFISPGAFKTLSN
LKILLLNDNQLHALDRLSFVELESLEELDLDSNPLSSFPDGTFASLSKLRKISIMSNQLS
CDCQIVDLLRLIKDHQVQVSNRTVCIFPHSLRGMQVAGLNAKALKRSCGKGNFNPAVFDL
EPTTRSIVVYPGDEKNITCKVSKANDVRMEWLKNNVPLVDSSRLFTMHYNDSEFLYLKLC
LNPVTWEDEGDWTCYVEQDRSALRNTVRMTPVLVNTVHCVQEWQADEKGEIIWAVSKQGL
VTAKCPNGPTNAKAYRRCKHGKWETPDTSRCAYTSPLIKYFLTLLQHKRTSQYMDELLRI
TRRPFEMSAYETRLVGWLIGNATGLSSRQMLAALNFVLQSEFARTELNGKLMRQHLQHLL
LGDKVIQEDNLAICQHLFAKGYDGTPAEIMKGGFLTLHDGSKFSCREQQFVELLPKTGGA
SLRIPRHTIDQFPSLTIVRVLWLSNSKIFESKHTSDGRWTVMSEVYGVAMKHIPIRLLQE
KLRRIVRDYSRSKSDEKVHAEVEKVALYGAIMEMYFIAYGIPLIAMSIVLATGTLSYDGS
PKL
Download sequence
Identical sequences Bm1_39825 XP_001899420.1.25112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]