SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_40270 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_40270
Domain Number 1 Region: 476-606
Classification Level Classification E-value
Superfamily TIMP-like 7.53e-29
Family Netrin-like domain (NTR/C345C module) 0.017
Further Details:      
 
Domain Number 2 Region: 290-348
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000215
Family Laminin-type module 0.054
Further Details:      
 
Domain Number 3 Region: 346-399
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000307
Family Laminin-type module 0.032
Further Details:      
 
Domain Number 4 Region: 409-449
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000391
Family Laminin-type module 0.012
Further Details:      
 
Weak hits

Sequence:  Bm1_40270
Domain Number - Region: 90-172
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000128
Family Galactose-binding domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1_40270
Sequence length 611
Comment | Brugia malayi Unc-6 protein precursor, putative (612 aa)
Sequence
MYSLLTFTLFFLLRIYHIWAAYFSQFSLREPEHDPCYDNAGRPIRCVPDFINAAFGKPVT
ASNTCGQYGPSRYCSLRENAMGVMEEVCNICDASSKTQSHPASHLTDLNNLQNVTCWMSE
PSTEYPHNVTLTLSLGKKYELTYISVQFCNRLADSMAFYKSMDFGKTWIPFQFYSTECQK
IYDRNPSIKIGKHNEQEALCTNTHALTSMPNRVAFATLEGRPSAFEFEHSPVLQDWVTAT
DIRIIFNRLSPDQAELYGLTNEIGVNITDMDQLKQRYYYSVGELAVGGRCKCNGHASRCI
LDKTGNYICDCKHNTAGADCEHCKTFHLDRPWGRATSENANHCVACNCNLHAKRCRFNME
LYRLSGNKSGGVCINCRHNTAGRNCHYCKPGYFRDLTKSVTHRKACKACNCHPVGSLSRS
CNQSSGQCICKDGVTGLTCNQCSKGYQQSRSPLHPCIRKPSHITSYCNSDVALLSKCPKC
RAAPKRLTQKKYCRREYAVEVQVTRRESVDGWSKYQLIVLAIYKRDTGIRLRRGEQSLWI
SGKRTACKCPKIRVGRKYLILGQNDTNNISRPGIVFGTRTVVLEWNDEDLEKIMRFSKKE
KKGQCPARRRF
Download sequence
Identical sequences XP_001899511.1.25112 Bm1_40270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]