SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_40900 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_40900
Domain Number 1 Region: 290-588
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 1.27e-34
Family Galactose oxidase, central domain 0.022
Further Details:      
 
Domain Number 2 Region: 896-952
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000209
Family Laminin-type module 0.0068
Further Details:      
 
Domain Number 3 Region: 63-133,164-204
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000314
Family Spermadhesin, CUB domain 0.007
Further Details:      
 
Weak hits

Sequence:  Bm1_40900
Domain Number - Region: 835-860
Classification Level Classification E-value
Superfamily Plexin repeat 0.000246
Family Plexin repeat 0.0044
Further Details:      
 
Domain Number - Region: 952-997
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00142
Family Laminin-type module 0.0097
Further Details:      
 
Domain Number - Region: 210-235
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0285
Family EGF-type module 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm1_40900
Sequence length 1274
Comment | Brugia malayi Kelch motif family protein (1275 aa)
Sequence
MGAALLAAMFLHASTVIYSSVHIERIGSASVSKNCDNKPCYQGKCENEKCRCFAGWGGVQ
CDRCHGRNLLTDENELLTDGPRNYSSSSRCMWIIKDEKKRGALLLRIDSLVTECSWDHLY
IYDGTGTRSHQLAAFRCFCAWKNNDLLCYLRQCVSMEAILNSFRYNSSGVISGREVSIRS
GKALVYFFSDLAFNMSGFNITFAYGKCLNNCTSNGKCTEGICECYEGYTGALCDTLICTD
KDRNKTSKACGMAGICSADNRCSCNMHFHGDRCQALTTQSVFETVLTSGDFGARASHTAI
LVNDTKIWVIGGAHFTGVNNSFVAVYDITKSSWHKIPTRNTPRSRYDHTVVRYKSTIYMF
GGVIDERIVTNELWSLDLATLEWTLENNNNNASNAVPGAVAGHAAHLIGDEMFVFYGHSP
YFGYMYSIQKYKISTKRWSIVPDRGPHVQGRFGHSLVAYVHEKKEVILIYGGYLLPYEGF
LSRVSSTLIEYVCDNRECSHRTLSSGHTPVFRHSASLINDLMIIVGGNVHNESSSRIQEC
YSSDIQAYDIGCDTWFTLSNNNLPFLQRYGHSSMVTKHNIFVIGGFNGVMLSDVVKFTPA
ECGGLKRPDDCRNMREGVRCIFHAGKCKSVQRDVSYAHSFLSYVKNEDPKEEQKCPISWR
KAPSWCSEEKDCASCTAVEGCSWCHWSRECVSDNLCKDRTNPVAKSDACPKDEEPRPCFF
AAECFACKKLKHCNLSLEGEAPQQQHSYSQSEHTSLLALNALNPSSKNESCPAPCWFHDD
CQVCIKEQCMWCPTTSRCVSMDAYMVNFPYGQCQSWVTATNIISNQHACQLDPMDCSKQK
TCAECQRVGPNCGWCDDGSGTGLGKCLPGSLEAPDNELFCPKDGKSKWYFTNCSACQCNG
HSNCTLRRRSLEWNIEERSCTQCDHNTTGEHCQFCADGFYGDPRNGGRCEECFCNGQATM
CNRETGDCYCTTKGVTGKNCSKCEPKYYGDPENNQLCYYELTVDFIFTFKLDQDDPKDKY
VNQINFFSTPHKRDTDVQFTVVCESPKSEKALVSMSINSSLFEGHAGSNKLLMTRTVCDE
NGIRRAYSANAEPGFVFGTDANTTFLVKVYNFSTPIKIQISFSQSPPINWVLFFVIFAAC
FVVLLVVAGLLWMIKLRIEVFRRNQRRYDEIEQMASRPFASVRLELTSPRANLMATPISV
EPCSNYRSGVFTLAVRLPTGGRQFTPHGTSGLAVASALCLLTQAQLGVLQAAEASDANHN
RKTTLMRYIPFIRS
Download sequence
Identical sequences XP_001899640.1.25112 Bm1_40900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]