SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_45430 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_45430
Domain Number 1 Region: 269-306
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000361
Family EGF-type module 0.011
Further Details:      
 
Domain Number 2 Region: 257-392
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000298
Family Growth factor receptor domain 0.016
Further Details:      
 
Weak hits

Sequence:  Bm1_45430
Domain Number - Region: 414-446
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00183
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm1_45430
Sequence length 486
Comment | Brugia malayi Calcium binding EGF domain containing protein (487 aa)
Sequence
MLHPLLLLWTTLFGALLCPSNAITKSFVNSSMPDMRPTFVVNFDTGTVICQHSPHPDDLH
LHQISIICDGKPDCYSNPAMHDESFPYCAVTDKIVNIGSALFASAKRLQVAGVTQHAVNG
VHACSMELRGSATAMPDIMDLTVSLMMTMSVRISPVIGWHIAAILTARILAPASRGFKET
DTSAPILMNVRQAQRSARIIQHASICRGRISATALKGISRWAYLLNVALISMNAHKKFMI
AQKILSARMKIQNVVEKCDTGYRLVNGTCVDIDECMEKISECNSRATCVNAAGSYQCICE
DGFYRRCQQEGICDRHAFCIGTLRMCICQSGYVGDGLNCYDVNECAARHNPCEGQISELR
CVNIDGGYICCEQHLDDKRCIREKGAFCSGGCGLQAVCYNETCQCMEGFSGDPRIKCSDI
NECEDDKQCPGAGEWCVNLFGGFICXNADSKNPECSGSNSKLNGNIFTMIFTSIFTATSH
NRFNHV
Download sequence
Identical sequences Bm1_45430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]