SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_51140 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_51140
Domain Number 1 Region: 22-83
Classification Level Classification E-value
Superfamily BPTI-like 0.00000000000000142
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0099
Further Details:      
 
Domain Number 2 Region: 275-342
Classification Level Classification E-value
Superfamily BPTI-like 0.000000000132
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.018
Further Details:      
 
Domain Number 3 Region: 231-278
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000014
Family EGF-type module 0.028
Further Details:      
 
Domain Number 4 Region: 161-198
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000023
Family EGF-type module 0.034
Further Details:      
 
Weak hits

Sequence:  Bm1_51140
Domain Number - Region: 84-199
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000314
Family Growth factor receptor domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1_51140
Sequence length 384
Comment | Brugia malayi Calcium binding EGF domain containing protein (385 aa)
Sequence
MRPIKNAKSFTTVDVWAIEIASIASNSVCLLDVHPGYCNDDRKGHWWYYFNATDGDCQRF
FYYGCGGNDNRFYSHYHCEKMCGERLALDTDGTFLVTTGPSGHYTCECREGCFCFDHNFV
VCDRCDVRTSICIIHSKYNYVCECREGFVKNVGGECVDLDECRNRNSVCDRNAQCVNMVG
SYTCKCNIGYNGDGKKCTYVGIGRTTTNCAKCSPNAICSQGVCTCNIGFKGDGLNCTDID
ECLSWPRACHYHAKCHNIKGSYQCECRSGYAGNGYNCTSAPSACTNSFDPQYSNQCGIGN
WRPHYYYDYEKNRCRSFWYDGCPGKSMNIFSDANTCQVLCENLTDENLSNEFNRRGICWD
VLDTDHLNRCRNGMYFSLNSSVIH
Download sequence
Identical sequences XP_001901696.1.25112 Bm1_51140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]