SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_54795 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_54795
Domain Number 1 Region: 44-175
Classification Level Classification E-value
Superfamily POZ domain 1.36e-30
Family BTB/POZ domain 0.0022
Further Details:      
 
Domain Number 2 Region: 328-407
Classification Level Classification E-value
Superfamily Kelch motif 0.0000000000000126
Family Kelch motif 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1_54795
Sequence length 414
Comment | Brugia malayi BTB/POZ domain containing protein (415 aa)
Sequence
MERWRAESESTEVVIGTLESETHFCTSPSSLARHFNSKQSSTVYNNDNFPSNVLRSLNTF
RKDERFCDVILMASLKPEDGAESDGSRDVKIVAHRAVLAAGCPYFSAMFSGAMKESKQEN
IFLKGIDGTSLLALIDYMYSGRLTINEQNVQSLLTTGSLLQMACVRDACSRFLLEQLDPS
NCLGIANFAVAHGCTQLAHAATTFVQQHFNHVVKCDEFLALSKHQVVEIISSDHLTTTGE
DKVYEAVVRWVMHDILNRRDAFPDLMAHVRLPLLPRDYLTDKVDPDILVRQSSECKDYLL
EAYRYHLKDERGEENERSRPRQPIPLSKLIMLIGGQAPKAIANVDVFDLDALRWMPLNAL
PQRRCRCGVGELKDFVYAVGGFNGSLRVKSVDAYDVHTDRWFAAPPMDARYMHN
Download sequence
Identical sequences XP_001902417.1.25112 Bm1_54795

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]