SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra000048 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra000048
Domain Number 1 Region: 759-889
Classification Level Classification E-value
Superfamily TPR-like 0.000000000000025
Family Tetratricopeptide repeat (TPR) 0.015
Further Details:      
 
Domain Number 2 Region: 524-588,681-724,753-817
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000405
Family Tetratricopeptide repeat (TPR) 0.019
Further Details:      
 
Domain Number 3 Region: 221-324
Classification Level Classification E-value
Superfamily POZ domain 0.0000000204
Family BTB/POZ domain 0.017
Further Details:      
 
Domain Number 4 Region: 428-486
Classification Level Classification E-value
Superfamily HCP-like 0.0000759
Family HCP-like 0.025
Further Details:      
 
Weak hits

Sequence:  Bra000048
Domain Number - Region: 340-400
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.0412
Family BCR-homology GTPase activation domain (BH-domain) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bra000048
Sequence length 934
Sequence
MHPNLFTTMRTLKFIEGCKATALNPPPPPPPPSTTERAGEKLFQHLHDHLRVNSFRSKST
RTHPPPNQNAAVSKNSLLPYGLPNTDLLEPQIDPSLKFVDLIDKLAEVYRRIENSSQFEK
AEAFLEQCAIFRGLLDPKLFRRSLRSARQHAVNVHTKVVLASWLRYERREDELIGTTSMD
CCGRNLECPKASLVSGYDPERVYDPCICSGYNADVDVEECSTSEVDYDMSFCIGDEEVPC
VRCKIASLSIPFKAMLYGGFRETKRNTINFTRNGISVEGMRAVEMFSRVRKVEMFPPNVV
LELLTLANQFCCDELKAACDVFLARLVSNFDDAVLLIEYGLEEAAYLLVAACLQVFLREL
PNSMRNPNVVKILCSVEGRERLALVGHASFTLYLFLSQIAMEDDMNSNTTVMVLECLVEH
AVETWQRQLACHQLGVVMLERKEYKDAQRWFNSAAKAGHVYSLVGVARSKFKLGHRYSAY
KTMNSLISGCSATGWMYQERSLYRIGEEKVLDIDIATDLDPTLTFPYKFRAVSLVEESQF
GAAVAELNKILRFKVSPDCLEMRAWISIAMKNFEGALKDIRALLTLEPNFLMFNKKIHGD
HMVELLRSLVQRRNQADCWMQLYDRWSSVDDIGSLAVVHHMLANDPGKSLLRFRQSLLLL
RLNCQKAAMRSLRLARNHSKSEHERLVYEGWILYDTGHREEALAKAEESVSIQRSFEAYF
LKAYALADSTLDPESSKYVIQLLEEALRCPSDGLRKGQALNNLGSVYVDCGKLDLAADCY
KNALTIKHTRAHQGLARVYHLKSQRKDAYNEMTKLIEKAQNNASAFEKRSEYCDREVAQR
DLVMATQLDPLRTYPYRYRAAVLMDDHKEIEAIEELSKAIAFKPDLQLLHLRAAFFASMR
ETTDAIRDCEAALSIDPCHKDTINLYHKVREPQA
Download sequence
Identical sequences M4C770
XP_009133242.1.100322 Bra000048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]