SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra000168 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra000168
Domain Number 1 Region: 135-465
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 1.27e-108
Family Mammalian PLC 0.0000413
Further Details:      
 
Domain Number 2 Region: 478-604
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.13e-28
Family PLC-like (P variant) 0.0044
Further Details:      
 
Domain Number 3 Region: 8-137
Classification Level Classification E-value
Superfamily EF-hand 0.000000159
Family Polcalcin 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bra000168
Sequence length 606
Sequence
MGKEKKTESYDNGSYNYKMFKCFNRKFKINEVQPTDDVRDAFCQFSVGGSGRGAGGDGDS
SDDGVMGAEQLCSFLDDNQVNSATTVAEAQRLIDEVIRRRHHVTRFTRHGLDLDDFFNFL
FYDDLNPPITPNVHQDMSAPLSHYFIYTGHNSYLTGNQLSSDCSEVPVIKALQRGVRVIE
LDLWPNSTGTDINVLHGRTLTTPVPLITCLKSIRDHAFSSSPYPVIITLEDHLTADLQAK
VAEMATQIFGQMLYYPESESLEEFPSPASLLHRIIISTKPPKEYLESRNPIGKQKENGNV
SPSSEEETPGTEEIQTLESILFYQDCDNKSDSDQEEEEASEDQKPAYKRLITIHAGKPKG
TVKEEMKVVVDKVRRLSLSEQELDRTCSSNSQDVVRFTQKNLLRIYPKGTRFNSSNYKPL
IGWTHGAQMIAFNMQGYGRSLWLMHGMFRANGGCGYVKKPNFLMKKGFHDEVFDPKKKLH
VKVYMGDGWRLDFSHTHFDTYSPPDFYTKVFIVGVPADNAKRKTRVIEDNWYPIWDEEFS
FPLTVPELALLRIEVREYDMSDKDDFGGQTCLPVSELRPGIRSVPLYDKKGEKMKSVRLL
MRFIFE
Download sequence
Identical sequences M4C7J0
Bra000168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]