SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra000206 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra000206
Domain Number 1 Region: 4-139
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000009
Family PLC-like (P variant) 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bra000206
Sequence length 338
Sequence
MGKTHIEICLISARGLRVGTGFGSSLLKHQWYAVGWIDPESKYCTTIDASRSDNPLWRTK
FATLLDDDDASKIQALHVEVYSREPIFLRKKLHGSATVSLKEFLVKYKKQSSVVEETGSY
QLRKVNSSKAQGFVDVSIRVSAERQDFGGFTGDFGGVMLSNNSGYNNTSGQNYMSGSSQH
PFASLNQPNNPNPFSVPPDKHHSPMPNPLTNNASPQMQQPYYPPPPPMQQPYYPPPPPST
STAGYMPSYMPRSENAVNIPSSSSGGAGRGYARPGPGGSAGLGAGAIVGAAAAFYGRDYL
SGGFDLPTSLPLPNFSIPNISLPNVSIPNGSISIDPPF
Download sequence
Identical sequences M4C7M8
Bra000206 XP_009133458.1.100322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]