SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra000402 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra000402
Domain Number 1 Region: 3-136
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000000746
Family Synaptotagmin-like (S variant) 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bra000402
Sequence length 202
Sequence
MTYSTMRRSLEIELISAEGLKVDRKPVKRKTFCIVRIDQESKACKPDELGGSYPVWKDKI
EMDMAMNGSVRFISIEVLYKTSGGAEKSVGLAKIPVTDFMGGFAPQGHLNFLSYRLRDDY
GDKSGIINVSIMVKPDGNGLKYTSPSMAAPADYAACSSQAAVAANGQMWRPRTSSSMALT
TGYRGRVVVTGVPVWGAYPRSS
Download sequence
Identical sequences A0A078IS61 M4C874
Bra000402 XP_009133750.1.100322 XP_013740652.1.73403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]