SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra000644 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Bra000644
Domain Number - Region: 44-102,140-199,514-660
Classification Level Classification E-value
Superfamily TPR-like 0.00243
Family Tetratricopeptide repeat (TPR) 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bra000644
Sequence length 686
Sequence
MAMDLKLIAAGLRHCGKLQAFKRGESIQAQLIKQGISNNVFLANNLISMHLDFRSLVDAQ
KVFDEMTERNIVTWTTMVSGYTSGGKPNKAIELYRSMLDSESEAPNEFLFSAVLKACGLV
GDLQLGRLIHERIGEENIKGDVVLMNAVLDMYVKNRRLSEANKAFSEISQPNLTSWNTLI
SGYCKEGLVNEAVRLFHRIPQPNAVSWNCLISGFVDKGSPRALEFLIMMHREGLKLDGFA
LPCGLKACSFGGLLTMGRQLHCCVLKSGFESSSFALSALIDMYSNCCSLSDAVDLFRQAK
LHSTVAVSNAMLSGFFINDENEAALWLLLQMYQSGLSFDSYTLSGALKICTNLINLRLGL
QVHGLVVISGYELDYIVGSILVDLHANVGNVQDAYRLFHRLPNKDIIAFSGLIRGCVKAG
FHSLAFDLFRELIKLGLHADQFVISSILKACSSLASLGWGKQIHGLCVKKGYESEPVTTT
GLIDMYVKGGEIDNGVVLFDGMLERDVVSWTGIIVGCGQNGQAKEAIRYFREMIDSGVEP
NEVTFYGVLSACRHSGMLEEARFVLESMRSEYGLEPCVEHYYCMVDLLGQAGMFQEAEEI
IKGMPFEPDKTIWMSLLTACGTHKNAELVTVIAEKLLSSFSEDPSVYTCISNVYATMGMW
DRLGEVREAAKKLGTKESGLSWIDIA
Download sequence
Identical sequences M4C8W6
Bra000644 XP_009134089.1.100322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]