SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra000844 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra000844
Domain Number 1 Region: 119-281
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 9.22e-33
Family BCR-homology GTPase activation domain (BH-domain) 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bra000844
Sequence length 424
Sequence
MTGLVMVTKGVGCAGRKGGGRGKSTVEEEEEEQNQQQLSLVEFLLTALRKSVVSCRVDNR
QDDVGVGGISSAVHQMEIGWPTNVRHITHVTFDRFHGFLGLPHELQVEIPCRVPSASVSV
FGVSAESMQCSYDEKGNSVPTILLLMQQRLYSQQGLKAEGIFRINPENSQEEHVRDQLNR
GIVPENIDVHCLAGLIKAWFRELPCGVLDGLSPEEVLNCNTEEDSVELIKQLKPTESALL
SWAVDLMADVVEEEESNKMNARNIAMVFAPNMTQVKTQTNITLVTFLRFTDVTDSSEREA
TSSGSEGYSPSHSSNSQTDSDSDNAQDMEVSCESQGTDSESGGEEEEGQQQQQQDEEHLS
RRSTQEDENDIGSLSSVEKCFLSQLNTNARVSNVSISQDWSPKCSPPVSFTDDKNDTLGS
STSD
Download sequence
Identical sequences M4C9G5
Bra000844

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]