SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra000868 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra000868
Domain Number 1 Region: 640-822
Classification Level Classification E-value
Superfamily TPR-like 2.37e-16
Family Tetratricopeptide repeat (TPR) 0.0083
Further Details:      
 
Domain Number 2 Region: 405-725
Classification Level Classification E-value
Superfamily TPR-like 0.00000000114
Family Tetratricopeptide repeat (TPR) 0.026
Further Details:      
 
Domain Number 3 Region: 327-444
Classification Level Classification E-value
Superfamily TPR-like 0.0000425
Family Tetratricopeptide repeat (TPR) 0.027
Further Details:      
 
Weak hits

Sequence:  Bra000868
Domain Number - Region: 223-281
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.00235
Family BCR-homology GTPase activation domain (BH-domain) 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bra000868
Sequence length 831
Sequence
MRTFYPSDSCSKESHLNSLNPQSWLQVERGKLSSSASSSAPLCRESFIKVPEPQILPHYK
PLDYVEVLAQIHEELESCSLQDRSSLYLLQYQVFRGLGETKLGQRSLRSAWQEATTVHEK
VVFGSWLRYEKQGEEVIAELLSSCGKYSEEFVPLDIASYLPVTSPEAASVKKEDASLSAP
YFSVANVLIGVSKNLLIEVLVFANKFCCERLKDACDRELASLVSSMECAVELMDFALEES
SPILAASCLQVFLYELPESLTDERVVEALTRVNRSHVSTMAGKASFSLYSCLTEVSMRLD
PRSDRTLSFLEKVVDFAESDRQRVLGFHRLGCTRLLRKEYREAEEAFETAFNLGHVYSAT
GLARIGYIQGHKLWGYEKLTSVISSVSPPLGWMYQERSLYCEGDKKLEDLEKATELDPTL
TYPYMYRAVKLMSEQNAEAALEEINRILGFKLALECLEIRFCLYLGMDDYEAALRDIQAA
LTLCPDYRMFDGKVAARQLRTLVYEHVESWTTADCWMQLYEKWSNVDDIGSLSVIYQMLE
ADACKGVLYFRQSLLLLRLKCPEAAMRSLQLAREHASSDHERLVYEGWILYDTGHCEEGL
QKAKESIRIKRSFEAYFLQAYALAESSLDPSSSSTVVSLLEDALKCPSDRLRKGQALNNL
GSVYVDCEKLDLAADCYINALKVRHTRAHQGLARVHFLRNDKAAAYEEMTRLIEKAQNNA
SAYEKRSEYCDRELAKSDLEMVTRLDPLRVYPYRYRAAVLMDSRKEKEAIEELSRAIAFK
ADLHLLHLRAAFHEHNGDVSSALRDCRAALSVDPNHQEMLELHSRVNSHEP
Download sequence
Identical sequences M4C9I9
Bra000868

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]