SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra001120 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra001120
Domain Number 1 Region: 18-272
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.99e-56
Family Ankyrin repeat 0.00014
Further Details:      
 
Domain Number 2 Region: 327-439
Classification Level Classification E-value
Superfamily TPR-like 3.8e-35
Family Tetratricopeptide repeat (TPR) 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bra001120
Sequence length 456
Sequence
MAPDASTALAAREKVQQFLNAACTGNLEFLKNVAKQLDEGKGLKTTVESVKDANKRGALH
FAAREGQTEICRYLLEELKLDADTKDEAGDTPLVHAARQGQVGTAKYLLDHGADPNIASE
LGATALHHAAGTGEIELLKELLSRGVPVDSQSESGTPLIWAAGHDQKEAVQVLLEHKANP
NAETEDNVTPLLSAVAAGSVACTKLLALARAKANVFAGGATPLHIAADIGDYELIIILLK
AGADPDQKDEEGNRALEVAALRENRTIVETLFRLTTKLESVSKWTVDGVIAHMKSKKEQE
GNSNSAKSGETVIKKDLPEVSPEAKAKAAEAKARGQDAFQRKDYQMAIDAYTQAIDFDPT
DHTFFSNRSLCWLLLGQGEHALSDAKACRELKPDWPKACYREGAALRLLQRFDEAANAFY
EGVLLSPESKELIDAFREAVDAGRKFHGKDKIKDKS
Download sequence
Identical sequences M4CA91
XP_009134782.1.100322 Bra001120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]