SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra001408 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra001408
Domain Number 1 Region: 252-509,658-788
Classification Level Classification E-value
Superfamily TPR-like 3.79e-55
Family Tetratricopeptide repeat (TPR) 0.001
Further Details:      
 
Domain Number 2 Region: 34-260
Classification Level Classification E-value
Superfamily TPR-like 1.52e-41
Family Tetratricopeptide repeat (TPR) 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bra001408
Sequence length 900
Sequence
MVVLEDNTERERSPPLVENGFANGPKAIQGNGNDNDTLSYANVLRARNKFSDALSLYETL
LERDSNNVEAHIGKGICLQTQSKVNLAFDCFGEAIRLDPHNACALTHCGILHKEEGRLVE
AAESYQRALMADASYKPAAECLAVVLTDLGTSLKLAGSTQEGIQKYYEALKIDPHYAPAY
YNLGVVYSEMMQYDSALGCYEKAALERPMYAEAYCNMGVIYKNRGDLEMAITCYERCLAV
SPNFEIAKNNMAIALTDLGTKVKLEGDVSQGVAYYKKALYYNWHYADAMYNLGVAYGEML
KFDMAIVFYELAFHFNPHCAEACNNLGVLYKDRDNLDKAVECYQMALSIKPNFAQSLNNL
GVVYTVQGKMDAAADTIEKAILANPTYAEAFNNLGVLYRDAGNITAAIDAYEECLKIDQD
SRNAGQNRLLAMNYINEGLDDKLYEAHRDWGWRFTRLHPQYTSWDNVKDPERPITIGYIS
PDFFTHSVSYFIEAPLTHHDYTKYRVVVYSAVVKADAKTFRFRDKVLKKGGVWKDIYGID
EKKIASMVRDDEIDILVELTGHTANNKLGTMACRPAPVQVTWIGYPNTTGLPTVDYRITD
SLADPLDTKQKQVEELVRLPDCFLCYTPSPEAGPVCPTPALSNGFVTFGSFNNLAKITPK
VLQVWARILCAVPNSRLVVKCKPFCSDSIRQRFLTTLEQLGLESKRVDLLPLILFNHDHM
QAYSLMDISLDTFPYAGTTTTCESLYMGVPCVTMAGSVHAHNVGVSLLSNVGLGRLVAKN
EDEYVRLSVDLASDVTALSKLRMSLRDLMAGSPVCNGPSFAVALESAYRSMWRSYCKGEV
PSLKRMEKLQKEVQEDPLISSRLNVTGEATPSLKANGSAPVPSSLPTQSWQLSKNRDSTS
Download sequence
Identical sequences M4CB29
XP_009135170.1.100322 XP_013648179.1.73403 Bra001408

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]