SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra001854 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra001854
Domain Number 1 Region: 759-1024
Classification Level Classification E-value
Superfamily L domain-like 1.58e-51
Family Polygalacturonase inhibiting protein PGIP 0.0092
Further Details:      
 
Domain Number 2 Region: 959-1287
Classification Level Classification E-value
Superfamily L domain-like 4.76e-37
Family Polygalacturonase inhibiting protein PGIP 0.014
Further Details:      
 
Domain Number 3 Region: 168-323,351-386
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.26e-25
Family Phospholipase D 0.065
Further Details:      
 
Domain Number 4 Region: 15-147
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.34e-25
Family PLC-like (P variant) 0.058
Further Details:      
 
Domain Number 5 Region: 451-564,610-684
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.26e-24
Family Phospholipase D 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bra001854
Sequence length 1534
Sequence
MSMEGSSNGSLRLVLLHGNLDVWVKEAKNLPNMDRFRRYKKNSTSDPFVTVSIAGAKIGT
TFVVDNDENPVWKQHFYVPVAHHAKVVKFVVKDSDRFGAKFIGDVGIPTEELCSGNTIEG
LFPILDSSGKPCKKGAVLSLSIQYSPVEMMKVYQMGVGNECEGVPGTYFPLRKGGRVTLY
QDAHVEDGTLPSVDLDGGMKYIHGKCWEDMADAIRQAKNLIYITGWSVYHTVRLVRRNND
PTDGTLGDLLKERSQEGVRVLLLVWDDPISWSFLGYRTEVQTIYTHHQKTVIVDAEAAQG
RRKIVAFVGGIDVCKGRFDTPKHPLFTTLKTLHKDDFYNNCFGTTEDDGPRQPWHDLHSM
IDGPAAYDVLANFEQRWLKASEKRHRISIHRSSSEDALLKIDRIPNIMGLSEASFVDDND
PESWHVQVFRSIDSTSVKGFPEDSKEASARNLQCGKNILIDMSIHTAYVKAIRSAQHFIY
IENQYFFGSSFNWDSHKIVGANNLIPMEIALKIANKIRARENFAAYIVIPMLPEGDPTGI
VTQSILQYQYKTMQMMYLTIYKALVEAELDGQYEPQDYLNFFCLGTREVADGNVNNNTKE
EDGPQVEALKSRRFMIYVHSKGMIVDDEFVLIGSANINERSLEGSRDTEIAMGGYQPHHS
WAKKGSHPRGQIFGYRMSLWAEHLGSLEKGFENPENMECVRRVRRLSELNWRQYAAEEVT
EMTSHLLKYPVQVDRAGKVSSLPGCETFPDVFVDPARHLCHPDQRDAILDFKNKFQIQKP
CLDRRLKSWENNSDCCSWDGIRCDASFGDVIKLNLSDSCLHGQFNSNSTIFLLQRLPFLT
TLDLSSNELSGNIPSSLGNLSKLTTLDLSGNDFSGEIPSSLGNLSKLTTLNNLSQNKFTG
KVPSSLGNLLNLTELILCANNFVGEFPSSFGNLSHLTVLDLSQNNFVGEISSFFGSSDHL
TDMDVGNNILHGNFPLKLLNLTKLISISISGNQFSGMLPPNMGSLSNLEFFYVEHNTFTG
PIPSSSLFTIPSLTYIDLSNNQLNGTLELGNISESSRIEDLSLGDNNFMGSIPRSISKLV
NLDTLDLSHLNTQGSVVDLSIFWHLKSLYSLSLSHLNTTTTLVLNAILPYLKSLHTLDLS
GNHVSTENSSLVSDPPLLGELNLSGCGIFEFPELLRTQRNMKTLDISNNKITGQVPGWLW
ELPIIEYVSTSNNTLIGFESPTKHGISYVRKTSLSYLSGANNNFTGKIPSFICELRSLTT
LDLSNNKFSGSFPSCLGNFSRSLEVLNARVRARRVRLSLECETGQQTLQQQEGWCDSIGS
VEQIQAKLIKRQEGADKRERAMAYALTHQWQAGTRQLSTHSGFQPDKNNWGWNWLERWMA
VRPWENRFLDSSTLREDANLNSMEQCENVHRTQMKSASRMPNTSTLVSGVSSGKATRPSL
SDNDSSSPGSIPVVSKARSKLVKDDLAVEVNSRRHGAGPRSHSNPKERLSLPNSGKSLGS
RSGKAIIGAGKLTQASAQNQRRRNSDPIKQRLLA
Download sequence
Identical sequences M4CCC4
Bra001854

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]