SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra001954 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Bra001954
Domain Number - Region: 253-485
Classification Level Classification E-value
Superfamily TPR-like 0.0357
Family Tetratricopeptide repeat (TPR) 0.035
Further Details:      
 
Domain Number - Region: 151-248
Classification Level Classification E-value
Superfamily HAD-like 0.0888
Family Histidinol phosphatase-like 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bra001954
Sequence length 494
Sequence
MSSSTLKRILHRTLNPKPDSTHSSSISLFTTVSSPPSDPSNPTSPPDPLVTDAVSILTHH
RSKSRWSTLRSLTPSGFTPSQFSDIALRLRNNAHLSLRFFLFTRRNSLCSHDVDSCSTLI
HILSRSRLKSHARDVLRLALRIPSSEDRVPKVFRSLIKSYNRCGSAPFVFDLLVKSCLDS
KAIDGAVMVMRKLKSRGINLQITTCNALISEVSRRRDASTGYKLYREVFGLDEANKVKPN
VNTFNLMMVSFYREGETEMVERIWREMEEEVGCFPNVYSFSVLMETYCFRGMMVEAERVW
EEMRLKGVVHDVVAYNTMIGGLCSNLEVTKAKKLFEDMGSKGLECTSLTYDHLVRGYCKV
KDVDSAMVAYREMESKSFVAEGLTIEALVEGLCDGNKERVVEAAEIVKEAVRESEFCPSR
KCYELLIKRLCEEGKMDRALSIQAEMVGRGLKPSQETYKAFIDGYGRAGDEETSSLLAIE
MAESLKLRDEEEES
Download sequence
Identical sequences M4CCM4
XP_009121238.1.100322 Bra001954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]