SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra002043 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra002043
Domain Number 1 Region: 133-276
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.67e-31
Family BCR-homology GTPase activation domain (BH-domain) 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bra002043
Sequence length 492
Sequence
MAKVLNSTQSCRFPSPSSSSSSTSCGGVNDGNRDPHSLFNISREEEEEEEERSEKEEERF
ELSSALEILVSAIRRSVIGGCVGEEDLCSMEIGVPSDVRHVAHVTFDRFHGFLGLPVEFE
PEVPRRAPSASRGGLQVEGIFRINGENGQEEYTREELNKGVIPDNIDVHCLASLIKAWFR
ELPTGVLDSLSPEQVMESETEDECAELVKLLPPTEASLLDWSINLMADVVEMEHLNKMNA
RNIAMVFAPNMTQMLDPLTALMYAVKVMNFLKTLIVKTLKERKESRDRLVQGSNPGPRDH
NGDQSSRQLLHLMKANEEEAVVDTFEVEMKEKEESSELQELVGLKSSLIKSCQYGKGGFG
EKQNGWEEERKMKRTMSNASSIVGPSPLKATKTVLLQKPDSAKAFDSFLEKRKPTVSIAS
PLSTREELRESLPKAEPSSKETVVGKSSDNNGEASGGSDTDDWSAVQERALVQALKTFPK
ETSQLQLFLGRR
Download sequence
Identical sequences M4CCW2
Bra002043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]