SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra002555 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra002555
Domain Number 1 Region: 325-491
Classification Level Classification E-value
Superfamily TPR-like 0.00000286
Family Tetratricopeptide repeat (TPR) 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bra002555
Sequence length 534
Sequence
MKRFSTLPCSLRLSSIVSYAELIETNGRDRLLPQGKKLHAHLVTSGIARLTRIAAKLVAF
YVECGEVTDAKKVFDEMPKRDISGWVVMIGACSRNGYYQESLNIFREMNGEGLKLDAFIV
PSVLKASRNLLDQEFGKMMHCVVLKCSFESDGFIVSSLIDMYSKFGEVENARKVFRDSSG
QDLVVFNAMISGYANNSQADEALNLMGDMELLGIKPDVITWNALIAGFSHIGDEEKVSEM
LEMMCLHGHKPDVVSWTSIISGLVHNFQNAKALDAFKQMLAHGLYPNSATITTLLPACTT
LASVKHGKEIHGYSVVSGLEDHGFVRSALLDMYGKCGFISEAMILFHKTTKKTTVTFNSM
IFCYANHGLSEKAVELFERMEATGERLDHLTFTAILTACSHGGLTDLGQKLFLLMQNKYR
IEPRLEHYACMVDLLGRAGKVVEAYEMIRAMPMEPDLFVWGALLGACRNHGNIELARIAA
ERLAELEPENSGNRLLLSSLYANAGSWGSVVRMKKMIKKKKLSRVPGSSWVNTV
Download sequence
Identical sequences M4CEC4
Bra002555 XP_009120470.1.100322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]