SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra002625 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra002625
Domain Number 1 Region: 112-452
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 6.28e-110
Family Mammalian PLC 0.0000472
Further Details:      
 
Domain Number 2 Region: 461-588
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.21e-28
Family PLC-like (P variant) 0.0078
Further Details:      
 
Weak hits

Sequence:  Bra002625
Domain Number - Region: 15-110
Classification Level Classification E-value
Superfamily EF-hand 0.00598
Family Calmodulin-like 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bra002625
Sequence length 589
Sequence
MGSYRMCLIFKRKFRVTEPGPVDDVRDVFSRYAEGQAHMSPEQLRKLMADERREDLGSSL
EDAERLVDEVLRRKHHIAKFTRRNLTLEDFNYLLFSTELNPPIGDKVHQNMDAPLSHYFI
FTGHNSYLTGNQLSSKCSGLPIADALRKGVRVVELDLWPRGKDDVCVKHGGTLTKAVKLG
KCLESIKANAFTTSKYPVIITLEDHLTPKLQCKVAKMITQTFGEMLYYHDSESCKEFPSP
EELKGKILISTKPPKEYLEANDAKDGEKGKDSDEDVWGKEPEELISTQSELDKVSNNINY
INQDDEERGSRDFDTSCSLQAPEYKRLIAIHAGKPKGGLKMALKVDPDKIRRLSLSEQLL
EKAVASHGADVIRFTQKNFLRIYPKGTRFNSSNYKPQIGWMSGAQMIAFNMQGYGRALWL
MQGMFRANGGCGYVKKPDFLMNVGPNGEVFDPNENSHPKKTLKVKVLMGDGWHLDFKKTH
FDRYSPPDFYVRVGIAGAPADKAMEKTEVKYNTWTPIWNEEFTFQLTVPELALLRVEVHE
YDNNEKDDFGGQTCLPVSELRQGIRAVPLFNRKGVKYNSTRLLMRFEFV
Download sequence
Identical sequences M4CEJ4
XP_009120385.1.100322 XP_013716563.1.73403 Bra002625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]