SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra002638 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra002638
Domain Number 1 Region: 735-865
Classification Level Classification E-value
Superfamily TPR-like 0.000000000000109
Family Tetratricopeptide repeat (TPR) 0.012
Further Details:      
 
Domain Number 2 Region: 406-446,495-573
Classification Level Classification E-value
Superfamily TPR-like 0.00000000104
Family Tetratricopeptide repeat (TPR) 0.033
Further Details:      
 
Domain Number 3 Region: 539-574,629-714
Classification Level Classification E-value
Superfamily TPR-like 0.0000000123
Family Tetratricopeptide repeat (TPR) 0.035
Further Details:      
 
Domain Number 4 Region: 204-305
Classification Level Classification E-value
Superfamily POZ domain 0.0000000455
Family BTB/POZ domain 0.014
Further Details:      
 
Weak hits

Sequence:  Bra002638
Domain Number - Region: 321-380
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.0785
Family BCR-homology GTPase activation domain (BH-domain) 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bra002638
Sequence length 922
Sequence
MRNLKLFERFKSTQIHAFTSSQDSPSTSTNGSSSSPRMNFLRHPKPTSKSFSRSLLPHGF
PTTDLLEPPLDSYLKPIDLVESLSNLYRRIESSSESETSMLYLEQYTVLRSLGDAKLLRR
CLLNARRHAVDVPCKVVLSAWLRFERREHELVGVESMDCNGFAIECPKSSLSRGCDLNLV
NEHCKCCEEEEIKVSRADEFSGLDEESDFSFCVGLEKAKCVRSRIASLSRPFEAMLYGSF
VESRASEIDFSENGISVEAMVALNIYSRLKRVDLFRVETVFELLGLATKFCCDDLKSACE
SRLASSITDLDKALTFVDYALEERAELLLSACLQVFLRELPQSLHSSKVMRLFCSSEAKE
GLSFLGSECLFMLYYFLSQVGMEEKLSAEAMLVLLERTREFALANWQKAVALHQMGCVLF
ERKDYKAAQFHFRLASSLGHVYSLAGVSRTEYKQGKSHSAFKLMNYLISKHKPRGWMYQE
RSLYNAGDDEKLKDLATATELDPTLTFPYKYRAVMKFERKQVKEAFEEVDRLIQFKLTPD
CLELRAWLFLAVGDKESCLRDIRAVLTLEPKYVVFGGRMRGDLVEALTAQCSEVDCWVKL
YDRWSAVDDVGSLGVVHQMLQNDPSKNFLRFRQSLLLLRLNCQGAAMRCLRMAWNLAASE
AERLVYEGWLLYDMSYVDEALTKAEKAISIQRSFEAFFLKAYVLAEKNLDPDESSCVAQV
LEEALKCPSDGLRKGQALNNLGSIYIDCSMLDQAETAYKNALEIKHTRAHQGLARVYFLK
NQRKEACEEMTKLINKAFSKAAAYEKRTEDCGREKTKEDLDMATTLDPLRTCPYRYRAAV
LMDDQRETEAVEELSKAIAFRPELQTLHLRAAFHEATGKLSLAAQDCEAALCLDPNHTET
LHLYSRSKDQASSIDNTIAGLD
Download sequence
Identical sequences M4CEK7
Bra002638 XP_009120366.1.100322 XP_018511095.1.100322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]