SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra002751 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra002751
Domain Number 1 Region: 172-250
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000173
Family Polcalcin 0.075
Further Details:      
 
Domain Number 2 Region: 63-172
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000000951
Family Synaptotagmin-like (S variant) 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bra002751
Sequence length 509
Sequence
MGNGSSREGKESRRSRLKQKLQRFRTHRLHLRTRFSRNAAGVVNQRAVTVEDFSGIALLT
LIGADMKFKDKWLACVSFGEQTFRTEISDTTEKPIWNSEKKLLLEKNGPSLVRVSVFETN
RLSRNKIVGYCELDIFDFVVQEPESACKSFDLLDPASSNVVGTVFLSCAIEDPVETEKRF
AKRILSVVDYNEDGQLSFSEFSDLIRAFGNLVAANKKEELFKAADLNGDGVVSIDELAAL
LALQQEKEPIINNCPVCGEALQLTDKLNSMIHMTLCFDEGTGNQVMTGGFLTDRQASYGW
MFKLSEWTHLSTYDVGLNTGSNASHIVVIDRKTKRLVEELIDSKIVLSMRAIYQSKIGLR
LMDQGAKEILQRLSEKQGKKMNTVESAQKIPSFLEFFKDQINMAEVKYPLQHFKTFNEFF
IRELKPGARPIAYMNRDDVSVCAADCRLMAFQSVEDSTRFWIKGRKFSIRGLLGKNVNPN
AFLDGSLVIFRLAPQVHNENGSFLLIYEP
Download sequence
Identical sequences M4CEW9
Bra002751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]