SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra002899 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra002899
Domain Number 1 Region: 40-178
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.87e-17
Family Synaptotagmin-like (S variant) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bra002899
Sequence length 396
Sequence
MDSPQSVVSPFKIGESEKEKSTSVQSSGNRSNGIKTNGKDSDLVVGTLEVHVHQARDIHN
ICIYHKQDVYAKLCLTSDPENSVSTKIINGGGRDPVFDDKVKLDVRVLEETSLKCEIYMM
SRVRNYLEDQLLGFTLVPMSELLFKNGKLEKEFALSSSDLYHSPAGFVQLSLSYNGSYPE
VMAFPTMPSSVSVDEATKNPQGSESLPGELDKIEFPDPNVANENEKMVSEYFGISCSTID
SETCDSLVTSDTENHVTNSVTSVLKQDSPEISNATNEAASPHASAHSATETPNHDHLNSK
ADSQEESESEASKEKTVKPIFSVGVEQESKVVQQDIVDMYMKSMQQFTDSLAKMKLPLDI
DSPTISENSSSDSQKLPTPKSSNNGSRVYYGSRAFF
Download sequence
Identical sequences M4CFB7
Bra002899 XP_009120061.1.100322 XP_009120062.1.100322 XP_009120063.1.100322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]