SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra003180 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra003180
Domain Number 1 Region: 195-361
Classification Level Classification E-value
Superfamily TPR-like 0.0000000168
Family Tetratricopeptide repeat (TPR) 0.042
Further Details:      
 
Domain Number 2 Region: 100-144
Classification Level Classification E-value
Superfamily RING/U-box 0.000000053
Family RING finger domain, C3HC4 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bra003180
Sequence length 401
Sequence
MTTSVCPFSKAARPDNASSAPKQADTTPSACPFSKAARSDDAKQGETTASAACPFSKSAD
ASAPSKGCPEKEGRLSKEDSATVPAKCPFGYDSQTFKLGPFSCMLCQSLLFDSTRCVPCT
HVFCKVCLARFKDCPLCGADIESIEADENLQKLVDQFIEGHARIKRSLVNSADKEDDNKK
VIYADVSMERGSFLVQQAMRAFQAQNYESAKSRLAMCTEDIRDQLEREGNTPELCSQLGA
VLGMLGDCSRAMGDSSSAVNHFEESIEFLMKLPMHDLEITHTLSVSLNKIGDVKYNDGDL
QAARSYYIRALNVRRDAMKLHPNAPSQILDVAVSLAKVADIDRSLTNEDAAIDGFKEGMK
LLDSLKLDSEDSAALEQRRLSVMEFLKKQVEKPEQSAETAL
Download sequence
Identical sequences M4CG47
Bra003180 XP_009103916.1.100322 XP_013647959.1.73403 XP_013647960.1.73403 XP_018508741.1.100322 XP_018508742.1.100322 XP_018508743.1.100322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]