SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra003632 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra003632
Domain Number 1 Region: 173-369
Classification Level Classification E-value
Superfamily TPR-like 0.000000000000266
Family Tetratricopeptide repeat (TPR) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bra003632
Sequence length 376
Sequence
MFMTLAAANAVSFNSKLILFRIRCSDSNPKRGFGSKREEKDPSLLQRKSSSKQSVSAPRK
APGLNSQFEGKPGRSFDIDFEERLETIRRSALEKKKTEVVNEFGPIDYDAPAPVQTDQKT
IGLGTKVGVGIAVVVFGLVFALGDFLPTGSDSPTEKTSVVKNKISEEEKATLQQRLKEFE
TTLDGAPNDQTALEGAAVTLTNLGEYSRAATLLEKLAKERPTDPDVFRLLGEVNFELKNY
EGSIAAYKISEKVSKGIDLEVTRGLMNAYLAAKKPDEAVKFLLDTRERLNTRKTSTADSV
ELLLGKAYSDWGHISDAIAVYDRLITDHPEDFRGYLAKGILLKENGSRGDAERMFIQARF
FAPDKAKAFVDRYSKL
Download sequence
Identical sequences M4CHE9
Bra003632

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]