SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra004514 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra004514
Domain Number 1 Region: 144-322
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.35e-38
Family BCR-homology GTPase activation domain (BH-domain) 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bra004514
Sequence length 446
Sequence
MTNFSRSKSTGTTKFPDVKTTRPGPDIYENIHHDDYDYEEEHSTTSTDYYDVSTPLSSHG
SRSGPGSGQYTILDIFAAVLKKSLVMSCTMERGDDDVAASMDIGWPTEVKHVSHVTFDRF
SGFLGLPSELEPEVPPQAPSASVSVFGVSAKSMQCSYDNRGNSIPTILLRMQKRLYSEGG
LKAEGIFRINPDNGKEEHVRKQLNRGVIPRGIDVHCLAGLIKAWFRELPTGVLDVLTPEQ
VMKCNTEDDCNKLVTLLPPVESALLDWAIGLMADVVEHEQFNKMNARNVAMVFAPNMTQM
ADPLTALIHAVQVMNFLKTLILMTLKERENADAKARWIEKQTSDPSEEWEQQHSEILAPE
KPNHNPKFLRVATLCRLEADNEEKFWNTEKRNDHKDTTESTGTVQRLCKHPLFKSSRSTK
KPLVSNHDEGRRGRDAWGSRLSSLPW
Download sequence
Identical sequences M4CJY0
XP_009142613.1.100322 Bra004514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]