SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra004936 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra004936
Domain Number 1 Region: 2-136
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000000145
Family Synaptotagmin-like (S variant) 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bra004936
Sequence length 201
Sequence
MSYSTMKRSLEIELISAEGLKVDRKPVKRKTFCIVRIDQKTRVCKLDESGGSCPTWKDKI
EMEMPINGSVRFLSIEVLYRTSGGADKNVGFAKIPVTDFMGGFAPQGHLNFLSYRLRDEY
GDKSGIINVSIMVKPDGNNIKYSTPSPLVVATRDYAACSSQAAVNGQMWRPKTSSSMAVG
AGYGGREVTGVPVWCTYQQSS
Download sequence
Identical sequences M4CL50
Bra004936 XP_009143170.1.100322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]